SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001413 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001413
Domain Number 1 Region: 212-294
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 3.27e-36
Family Fibrinogen C-terminal domain-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001413   Gene: ENSDORG00000001517   Transcript: ENSDORT00000001515
Sequence length 295
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_26977:3452:20699:1 gene:ENSDORG00000001517 transcript:ENSDORT00000001515 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPSCGCVACTVLLSLAILLAVVVTAALLFLNHSPVPGTAPPPVVSTGPAGANSALVTVER
ADSSRLSITIDPRCPDLADGFARLEGAQASVLRALTERPAQARRAGAPGQELLDTLADQL
PRLLARASELQAECTGLRKVHSALGQGLSTLQSEQGHLIQLLSESQGHMAHLVNSIGDFL
DALQRDRGLGRPRVKADLQRAPARGVRPRGCASSPPPRDCLDVLLSGQQEDGVYSIFPTH
YPAGFQVYCDMRTDGGGWTVFQRREDGSVNFFRGWEAYREGFGKLTGEHWLGLKR
Download sequence
Identical sequences ENSDORP00000001413 ENSDORP00000001413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]