SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001428 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001428
Domain Number 1 Region: 207-331
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.52e-35
Family Reprolysin-like 0.00057
Further Details:      
 
Domain Number 2 Region: 421-497
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 4.71e-19
Family Blood coagulation inhibitor (disintegrin) 0.00019
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000001428
Domain Number - Region: 376-404
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0125
Family Reprolysin-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001428   Gene: ENSDORG00000001531   Transcript: ENSDORT00000001530
Sequence length 814
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5187:101228:200499:1 gene:ENSDORG00000001531 transcript:ENSDORT00000001530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSGAGSTPGSLLFWLLLCGPAGAVLAGERLGFQQTSHLSSYEIITPWRLTRERRETPRL
NSKQVSYVIQAQGKEHIIHLERNTDLLPKDFVVYTYNEEGTLISDHPNVQNHCHYRGYVE
GVYNSSVALSDCSGLRGLLHLGNSSYGIEPLHNSLYFEHLIYRMDDVQQEPLKCGVPNKD
TQETTNHGEEEQPSMTQLLRRRRAVLPQTRYVELFIVVDKERYDMMGRNQTAVREEMVRL
ANYLDSMYIMLNIRIVLVGLEIWTNRNLISITGGAGDVLGNFVQWREKYLITRRRHDSAQ
LVLKKGFGGTAGMAFVGTVCSRSHAGGINVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXGSRNFSSCSADDFEKLTLNKGGNCLLNIPKPDEAYSAPSCGNKLV
DPGEECDCGSPKECELDPCCEGSTCKLKSFAECAYGDCCKDCRFLPGGSLCRGKSSECDV
PEYCNGSSQFCQPDVFIQNGYPCQNNKAYCYDGMCQNYDAQCQVIFGSKAKSAPRDCFID
VNSKGDRFGNCGFSDNEYKKCATGNALCGKLQCENVHDMPVFGIVPSIIKTPSHGSYCWG
VDFHLGSDVPDPGMVNEGTKCDAGKICRNFQCVNVSVLNYDCDVQEKCHGHGVCNSNKNC
HCDSNWAPPNCEAKGYGGSVDSGPTYNEKSTALRDGLLVFFFLIVLIICAFLFIKRNKLR
KCPCKKRSQTYESDGKNPASVSRQSASASHSVSPVASSRQAPVQANRYPVPTYAARQPQR
FPSRPPPPHPKIPSQGNLVPARPAPAPPLYSSLT
Download sequence
Identical sequences ENSDORP00000001428 ENSDORP00000001428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]