SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001432 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001432
Domain Number 1 Region: 195-348
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.04e-39
Family Reprolysin-like 0.0003
Further Details:      
 
Domain Number 2 Region: 412-476
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 0.00000000777
Family Blood coagulation inhibitor (disintegrin) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001432   Gene: ENSDORG00000001533   Transcript: ENSDORT00000001534
Sequence length 773
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5187:204078:324467:1 gene:ENSDORG00000001533 transcript:ENSDORT00000001534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLVLQLAWLGGVLVSRPGSQNSIEIILPEKVQGSAQSKEGNEEVSYIIPNQPHMVHLK
QKYFLADHFVVYLYKQGSVTSHSSDIPAQCYYHGYIEGYPSSVATLSTCSGLRGMLQFEN
VSYGIEPLESAVEFQHILYKLGNENNVLESFNERGKTMEENQVDYSIFISKKXXXXXXXX
XXXXXXXXXXXXXXXYDYLGSDRVIVTNKVIEMVSLINSMFTQFNVTVVLSSLELWSDKN
KISTNGEADELLKRFLEWQQSYLALRPHDVSYLLIYKDHPNYVGATFPGKMCVSHYSVGI
AQSRVMTLEAFSVTVTQMLGINLGISYDDPQKCHCSEAVCVMSPKAVXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCGSSSCCTPGMC
VLKPTSQCDGANPNHRCCDSCKLQQSLECRPVRHPDCDLPEKCNGSSGFCPPDIHVLNGN
MCKGDKYFCHDGICHDLDQRCENVFGTGSTNGPFSCYEEIQXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXICVNFVCVEARALKTQAETCAQKCNGNGVCTNSEDLCKCKEGFNPPDCKSPSKRS
SVWTGKGGVTVEGISPKAEKKWLLGLYIGLPALVMATLVVVAWNNWKKWFAKKEECQSSX
XXXXXXXXXXXXXSRSEESTHTYTSRSTSEASSPANATRSKSRESTPTPFSGN
Download sequence
Identical sequences ENSDORP00000001432 ENSDORP00000001432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]