SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001438 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001438
Domain Number 1 Region: 73-314
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.4e-127
Family Ankyrin repeat 0.00000000254
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001438   Gene: ENSDORG00000001541   Transcript: ENSDORT00000001540
Sequence length 345
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1389:63399:69177:1 gene:ENSDORG00000001541 transcript:ENSDORT00000001540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRSQSPATDGQVGTPTEVAGAMAGVACLGKAADTDEWCDSGLGSLGPDAAAPGGPGLGAE
LGPGLSWAPLVFGYVTEDGDTALHLAVIHQHEPFLDFLLGFAAGTEYLDLQNDLGQTALH
LAAILGEASTVEKLYTAGASLLVAERGGHTALHLACRVRAHACACALLQPRPRDHTPDPS
PAPEPEYPEPSREKEEEQREEDWKLQLETENYEGHTPLHVAIIHKDAEMVRLLWHAGADL
NKPEPTCGRSPLHLAVEAQAADVLELLLRAGADPAAQMYGGRTPLGSALLRPNASLASLL
RAHGAPEPEDEDDKPGSSSSSDDSDSDSKDEGVSQEGNCGNDGSG
Download sequence
Identical sequences ENSDORP00000001438 ENSDORP00000001438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]