SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001440 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001440
Domain Number 1 Region: 181-490
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.24e-75
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000189
Further Details:      
 
Domain Number 2 Region: 58-179
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.00000000105
Family Seryl-tRNA synthetase (SerRS) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001440   Gene: ENSDORG00000001542   Transcript: ENSDORT00000001542
Sequence length 518
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1389:75083:81774:-1 gene:ENSDORG00000001542 transcript:ENSDORT00000001542 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASMARRLWPLLVRREFRPGGSCMCIPNAKRSFATEKRQRNLLYEHAREGYSDLPHLDM
EPLCACPEEAARLLELRKGELRPADLPAIISTWQELQQLQKQIRRLEAEKEAVAEAVRSL
LVNNNSSQVQKDPQYLGLRTQGREIRMQLSLLYPRETQLEEQFYLQALKLPNQTHPDVPV
GDESHARVLRVVGDKPAFSFRPRGHLEIGEKLNIIRQRRLSHVSGHRSYYLRGAGALLQH
GLVSFTLSKLVRRGFIPMTVPDLLRGAVFEGCGMTPNANPSQIYNIDPARFPDLNLAGTA
EVGLAGYFMDHAVAFRDLPIRMACSSTCYRAETDTGKEPWGLYRVHHFTKVEMFGVTGPG
LEQSSQLLDEFLALQVELLTELGLHFRVLDMPTQELGLPAYRKFDIEAWMPGRDCFGEVT
SASNCTDFQSRRLHIMFQTEAGELQFAHTVNATACAVPRLLIALLENNQQKDGSVLVPPA
LQPYVGSDRITAPTHAPLLYIGPNQPQKPRLPGQPASS
Download sequence
Identical sequences A0A1S3G106
XP_012881747.1.60039 ENSDORP00000001440 ENSDORP00000001440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]