SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001451 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001451
Domain Number 1 Region: 543-593
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000249
Family TSP-1 type 1 repeat 0.00046
Further Details:      
 
Domain Number 2 Region: 396-450
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.000000000108
Family Reprolysin-like 0.017
Further Details:      
 
Domain Number 3 Region: 972-1028
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000183
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 4 Region: 857-921
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000392
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 5 Region: 804-862
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000706
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000001451
Domain Number - Region: 925-967
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00011
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001451   Gene: ENSDORG00000001554   Transcript: ENSDORT00000001554
Sequence length 1097
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3364:1055:89687:-1 gene:ENSDORG00000001554 transcript:ENSDORT00000001554 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCDGVLLPPLVLPLLLLLLVWGLDPGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTDFCVHKDEPCDTVX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLGMNHDDDHSSCAGRSHIMSGEWVK
GRNPSDLSWSSCSRDDLENFLKSKVSTCLLITDPRSQHALRLPHKLPGMHYSANEQCQIL
FGTNATFCRNMEXXMCAGLWCLVEGDSSCKTKLDPPLDGTECGADKWCRAGECVSKTPIP
EHVDGDWSPWSPWSMCSRTCGTGARFRQRKCDNPPPEPEGTHCLGASVEHAVCENLPCPK
GLPSFRDQQCQAHDRLNSKRKGLLTAVVVDDKPCELYCSPLGKESPLLVADRVLDGTPCG
PYETDLCVHGRCQKIGCDGIIGSAAKEDRCGVCSGDSKTCRVVKGDFSHSRGTALKDSSK
RSINSDWKIELPGEFQIAGTTVRYVRRGLWEKISAKGPTKIPLHLMVLLFHDQNYGIHYE
YTIPVNSTAENQSEPARTQDALFIWTHSGWEGCSVQCGGGERRTIVSCTRIVNKTTTLVN
DSDCPQASRPEPQVRRCNIHPCQSRWVAGPWSPCSATCEGTQHREVTCVYQLPNGTHITT
RPLYCAGARATPVQSCEGQDCLSIWEASXXXXCSADCGQGTQKRTVMCTNSQGKCDSATR
PKAEETCEDYSGCYEWKTGDWSKCSSTCGKGLQSRVVQCMHKVTGRHGSECPALSKPAAY
RQCHQEACNDKINVNTITSPRLAALTYKCTRDQWTVYCRVIREKNLCQDMRWYQRCCQTC
RDFYATKMRPPPPPPSS
Download sequence
Identical sequences ENSDORP00000001451 ENSDORP00000001451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]