SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001452 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001452
Domain Number 1 Region: 35-209
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.21e-68
Family Ephrin receptor ligand binding domain 0.00000181
Further Details:      
 
Domain Number 2 Region: 656-930
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.78e-61
Family Protein kinases, catalytic subunit 0.0000000827
Further Details:      
 
Domain Number 3 Region: 932-1004
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.82e-16
Family SAM (sterile alpha motif) domain 0.00096
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000001452
Domain Number - Region: 465-499
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0201
Family Fibronectin type III 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001452   Gene: ENSDORG00000001556   Transcript: ENSDORT00000001555
Sequence length 1008
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2913:17088:49487:-1 gene:ENSDORG00000001556 transcript:ENSDORT00000001555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPGAGPHPLRPLACLVPLCLAVLWGPGRPGTAEEVVLLDSKASQAELGWTALPSNGWEE
ISGVDEHDRPIRTYQVCNVLEPNQDNWLQTGWISRGRGQRIFVEMQFTLRDCSSIPGAAG
TCKETFNVYYLETEADLGRGRPRLGGNRPRKIDTIAADESFTQGDLGERKMKLNTEVREI
GPLSRRGFHLAFQDVGACVALVSVRVYYKQCRATVRGLAAFPATAAESAFSTLVEVAGTC
VAHSEGESGSPPRMHCGADGEWLVPVGRCSCSAGFQERGDICEXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPWEEDEIRRDRVEPQSVSLSWREPVPA
GTPGANGTEYEIRYYEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXSPSIEVQTPGEAASGSRDQSPAVVVTVVTISALLVLGSVMSVLAIWRRPCSYGKXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHFGDLC
CGCLQLPGRQELPVAVHTLRDSCSDSQRLSFLAEALTLGQFDHSHIVRLEGVVTRGNPLM
IVTEYMSHGALDGFLRHHEGQLVAGQLMGLLPGLASAMKYLSEMGYVHRGLAARRVLVGS
GLVCKISGFGRGPRDRAEAVYTTMSGRSPALWAAPETLQFGHFSSASDVWSFGVVMWEVM
AFGERPYWDMSGQDVIKAVEDGFRLPPPRNCPSPLHRLMLDCWQKDPGERPRFSQIHSIL
SKMGQDPEPSKGVTTTSPRPPTPLADRAFSTFPSFGSVGAWLEALDLCRYKDSFAAAGYG
SLEAVAEMTAQDLVSLGISSAEHREALLSGISALRARVLQLQGQGVQV
Download sequence
Identical sequences ENSDORP00000001452 ENSDORP00000001452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]