SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001465 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001465
Domain Number 1 Region: 41-270
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.33e-48
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000537
Further Details:      
 
Domain Number 2 Region: 330-446
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.34e-43
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000173
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001465   Gene: ENSDORG00000001568   Transcript: ENSDORT00000001568
Sequence length 454
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_925:113:19723:1 gene:ENSDORG00000001568 transcript:ENSDORT00000001568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSWSRMYCTLAKRGHFSRISHGLQGVSAVPLRTYADQSIDADVTVIGSGPGGYVAAIKA
AQLGFKTVCIEKNETLGGTCLNVGCIPSKALLNNSHYYHLAHGKDFASRGIEMTGVHLNL
XXXXXXXXXXXXXFTGGIAHLFKQNKVVHVNGFGKITGKNQVTATKADGSTQVIDTKNIL
IATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKMVVIGAGVIGVELGSVWQRLGADVT
AVEFLGHVGGIGIDMEISKNFQRVLQKQGFKFKLNTKVTGATKKSDGKIDVILNIYAIGD
VVAGPMLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVAWVGKSEEQLKEEGIE
YKIGKFPFAANSRAKTNADTDGMVKILGQKSTDRILGAHILGPGAGEMVNEAALALEYGA
SCEDVARVCHAHPTLSEAFREANLAASFGKPINF
Download sequence
Identical sequences ENSDORP00000001465 ENSDORP00000001465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]