SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001467 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001467
Domain Number 1 Region: 341-393
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000109
Family Laminin-type module 0.046
Further Details:      
 
Domain Number 2 Region: 827-875
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000131
Family Laminin-type module 0.0065
Further Details:      
 
Domain Number 3 Region: 873-925
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000024
Family Laminin-type module 0.0033
Further Details:      
 
Domain Number 4 Region: 779-820
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000307
Family Laminin-type module 0.0065
Further Details:      
 
Domain Number 5 Region: 982-1033
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000642
Family Laminin-type module 0.0028
Further Details:      
 
Domain Number 6 Region: 934-984
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000067
Family Laminin-type module 0.064
Further Details:      
 
Domain Number 7 Region: 516-557
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000446
Family Laminin-type module 0.0076
Further Details:      
 
Domain Number 8 Region: 464-508
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000586
Family Laminin-type module 0.0075
Further Details:      
 
Domain Number 9 Region: 301-343
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000017
Family Laminin-type module 0.059
Further Details:      
 
Domain Number 10 Region: 1090-1132
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000232
Family Laminin-type module 0.025
Further Details:      
 
Domain Number 11 Region: 1034-1087
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000067
Family Laminin-type module 0.0021
Further Details:      
 
Domain Number 12 Region: 1138-1185
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000725
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 13 Region: 426-466
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000184
Family Laminin-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001467   Gene: ENSDORG00000001569   Transcript: ENSDORT00000001570
Sequence length 1792
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_925:25729:109668:-1 gene:ENSDORG00000001569 transcript:ENSDORT00000001570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVPPPRSSPPTLSIIPPVALCGARVRAQEPDFSYGCAEGSCYPVTGDLLIGRAQKLSVTS
TCGLHKPEPYCIVSHLQEDKKCFICNSQDPYHETLNPDSHLIENVVTTFAPNRLKIWWQS
ENGVENVTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKTWGVYRYFAYDCESSF
PGISTGPMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXV
HGHCMCRHNTKGLNCEQCMDFYHDLPWRRAEGRNSNACKKCNCNEHSSSCHFDMAVFLAT
GNVSGGVCDDCQHNTMGRNCEQCKPFYYQHPERDIRDPNLCERCSCDPAGSQNGGICDGY
TDFSAGLIAGQCRCKLYVEGEHCDVCKEGFYDLSAEDPFGCKSCACNPLGTIPGGNPCDS
ETGYCYCKRLVTGQRCDQCLPQHWGLSNDLDGCRPCDCDLGGALNNSCSPESGQCSCRPH
MIGRQCNEVESGYYFTTLDHYIYEAEEGHLGPGVTVVQRQYIQDRIPSWTGAGFVRVPEG
AYLEFFIDNIPYSMEYDILIRYEPQLPDHWEKAVITVQRPGKIPTSSRCGNTVPDDDNQV
VSLSPGSRYVVLPRPVCFEKGMNYTVRLELPQYTSYDSDVESPYTLIDSLVLMPYCKSLD
IFTIGGSGDGEVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALLHQMGLACE
CDPQGSLSSVCDPSGGQCQCRPNVVGRTCDRCAPGTFGFGPSGCRACDCDLQGSVNAFCD
AVTGQCQCFHGVYGRQCDRCLPGYWGFPSCQPCQCNGHADDCDLVTGECVNCQDYTMGHN
CERCLAGYYGNPIIGSGDHCRPCPCPDGPESGRQFANSCYQDPVTLQLACVCEPGYIGSR
CEDCASGFFGNPSDIGGSCQPCQCHHNIDTTDPEACDKETGRCLKCLYHTEGDHCQLCQH
GYYGDALRQDCRKCVCNDLGTVQQHCNGSDCQCDKATGQCLCLPNVIGQNCDRCAPNTWQ
LASGKGCEPCDCSAAHSFGPSCNEFSGQCQCMPGFGGRTCSECQELFWGDPDVECRACDC
DPRGIETPQCDQTTGQCVCVEGVEGPRCDKCTRGYSGVFPDCAPCHQCFALWDVIITELA
NRTHRFLEKAKALKISGVIGPYREIVDSVEKKVKEIEDILAQNPAAEPLKNIGHLFEEAE
KLTKDITEKMSQVEVKLADTASQNNSTAGELDLLXXXXXXXXXXXXXXXXXXXXXXXXXX
XXALDSITKYFQMSLEAEERVNATTTDPNNTVDQSASMRERVEDLLMEQESQFKEKQEEQ
ASLLDELAGKLQSLDLSAAAEMTCGTPPGEDCSQTECGGPNCRTDEGQKKCGGPGCGGLV
TVAHNAWQKAMDFDRDVLSALAEVEQLSKMVSEAKLRADEAKQNAQDVLLKTNTTKEKVD
KSNKDLRNLIKQIRDFLTEDGADLDSIEAVANEVLKMEMPSTPEQLQSLTEDIRGRVESL
SQVEVILQQSAADIARAETLLEEAKRAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXIESETVASEETLFNASQRISELERNVEELKRNATQNSGEAEYIEK
VVYTVKQNADDVKKTLDGELDEKYKKVESLIAKKTEESADARRKAEMLQNEAKTLLAQAN
SKLQLLKDLERKYEDNQKYLEDKAQELVRLEGEVRSLLQDISEKVTIYSTCL
Download sequence
Identical sequences ENSDORP00000001467 ENSDORP00000001467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]