SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001480 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001480
Domain Number 1 Region: 348-410
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.46e-23
Family Leishmanolysin 0.0054
Further Details:      
 
Domain Number 2 Region: 59-237
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 8.79e-22
Family Leishmanolysin 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001480   Gene: ENSDORG00000001583   Transcript: ENSDORT00000001583
Sequence length 653
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5885:13060:45561:1 gene:ENSDORG00000001583 transcript:ENSDORT00000001583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTTLGKMAAGWGGWARYPGAGPVPSRWRWYGSLWVRGVLLLLGGFPASAASVPVALSTS
PPCRHHVPTESEVINKVHLKTNHVVKRDADEHLRIKTVYDKSIDELLPEKRNLVKNKLFP
QAISYLEKTFQVRRPAGTILLSRQCATNQYLRKENDPHRYCTGECAVHTKCGPVIVPEEH
LQQCRVCRGGKWPCGAVGVLDQEGVRDADFVLYVGALATERCSHENIISYAAYCQQEAKM
DXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEARKHFNCPVL
EGMELENQGGMGTELNHWEKRLLENEAMTGSHTQNRVLSRITLALMEDTGXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXLCSRSSLVVTLWLLLGNLFPLLAGFLLCVWH
Download sequence
Identical sequences ENSDORP00000001480 ENSDORP00000001480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]