SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001489 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001489
Domain Number 1 Region: 24-144
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.96e-33
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000002
Further Details:      
 
Domain Number 2 Region: 326-437
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 3.44e-27
Family Anticodon-binding domain of Class II aaRS 0.0000014
Further Details:      
 
Domain Number 3 Region: 279-312
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 0.00000385
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001489   Gene: ENSDORG00000001592   Transcript: ENSDORT00000001592
Sequence length 442
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5914:33114:46591:-1 gene:ENSDORG00000001592 transcript:ENSDORT00000001592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLEERLGPHAEALGDAGDAEARAEPLLELCQKRHFLRGSQPPPSRDSLLSGCHPGFGPLG
VELRKNLAAEWWASLAAFREQVFAVDALHHQPGPTAPGDPAFGLVPAEALREILQDRDLS
KEQLVACLENLVRTSGKLRESLLHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGRDGRKNVVPSVLSVNGDLD
CGVLAYLYDSLQLTENSFARKNTLHRKVLKLHPSLAPVKVALDMGRGSTVELRQVCQGLF
NELLENGISVWPGYQETVHSSMDQLYSKYDEMSVLFTILITESTLENGLVHLRSRDTTMK
EMMHIAKLKDFLTKYISAAKNV
Download sequence
Identical sequences ENSDORP00000001489 ENSDORP00000001489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]