SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001500 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001500
Domain Number 1 Region: 1-35
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 0.0000318
Family Dual specificity phosphatase-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001500   Gene: ENSDORG00000001604   Transcript: ENSDORT00000001604
Sequence length 223
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_34412:6812:13559:1 gene:ENSDORG00000001604 transcript:ENSDORT00000001604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HAGVSRSVAVVTAFMMKTDQLSFEKAYENLQTIKPEAXXXXXXXXXXXXXXVMGEVDTSS
AIYKQYRLQKVTEKYPELQNLPQELFAVDPTTISQGLKDEILYKCRKCRRSLFRSSSILD
HNEGSGPIAFAHKRTPSFMLTTGTQSQCTSYFIEPVQWMESTLLGVIDGQLLCPKCSAKL
GSFNWYGEQCSCGRWITPAFQIHKNRVDEMKTLPVLGSQTRKV
Download sequence
Identical sequences ENSDORP00000001500 ENSDORP00000001500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]