SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001545 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001545
Domain Number 1 Region: 35-215
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.01e-55
Family SPRY domain 0.000000112
Further Details:      
 
Domain Number 2 Region: 204-241
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000811
Family SOCS box-like 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001545   Gene: ENSDORG00000001651   Transcript: ENSDORT00000001651
Sequence length 242
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5540:95:21943:1 gene:ENSDORG00000001651 transcript:ENSDORT00000001651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETRRHARIDQLLNITAPAAKQLRHANAENQTMKKFIKDNDRLTFHRHPVAQSSEGIRGKV
GHARGLHAWQIHWPARQRGTHAVVGVATARAPLHAVGYTALVGSDAESWGWDLGRGRLYH
DGDHRPGAAYPAGLAPGEAFATPDSLLVLLDMDAGTLSFVADGRYLGVAFRGLRGRKLYP
VVSAVWGHCEVTMRYINGLDPEPLPLMDLCRRAIRLALGRHRLQDISALPLPEALKNYLQ
YQ
Download sequence
Identical sequences ENSDORP00000001545 ENSDORP00000001545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]