SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001580 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001580
Domain Number 1 Region: 8-141,176-279
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.99e-49
Family Ankyrin repeat 0.00098
Further Details:      
 
Domain Number 2 Region: 655-714
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000275
Family SAM (sterile alpha motif) domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000001580
Domain Number - Region: 132-175
Classification Level Classification E-value
Superfamily Soluble secreted chemokine inhibitor, VCCI 0.0889
Family Soluble secreted chemokine inhibitor, VCCI 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001580   Gene: ENSDORG00000001689   Transcript: ENSDORT00000001691
Sequence length 750
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3098:285207:326247:-1 gene:ENSDORG00000001689 transcript:ENSDORT00000001691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CGHTNVAHLLLDHGADVNAQNRLGASVLTVAARGGHLGVVKLLLEAGAIVDHHSPSGEQP
GMGGSRDELLDITALMAATQHGHEAVARLLMEWGADPNHTARTVGWSPLMLAALSGRLGM
AQQLVEKGANPDHLSVLEKTAFEIALDCKHRDLADFLDPVTTVRPKTDEEKRRPDIFHAL
KMGNFQLVKEIADEDPNHVNLVNGDGATPLMLAAVTGQLLLVQLLVERHADIDKQDSVHG
WTALMQATYHGNKEIVKYLLNQGADVTLRAKNGYTAFDLVMLLNDPDTELVRLLASVCMQ
VTKDKGRPTQPPLLPHSKVRQPWSIPVLPDDKGGLKSWWNRMSNRFRKLKLMQTLPRGLS
SNQPLPFSDEPEPALDSTMRAASQDRTGRPWPPDAASVAKDSGPGNPRGEKEDALLTTML
RNGAPFPRLPSDKLKAVIPPFLPPSSFELWSSDRSRTCHNGKADPPKTMPQRGSRTHPVG
SGGTDAGMARPVKFPSLSRNPASPTSSGNFNHSPHSSGGSSGAGGVSRHSGDLHNRSGGS
VDSVLSQIAAQRKKAAGLSEQKPSQRSSPIGPPAPSSAELPASPAAGSAPSKQKLDTSQR
PSSGTSTTSKSTSPTLTPSPSPKGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELTGI
LKKLSLEKYQPIFEEQEVDMEAFLTLTDGDLQELGIKTDGSRQQILAAISELNAGKGRER
QILQETIHNFHSSFESSASNTRAPGNRPCT
Download sequence
Identical sequences ENSDORP00000001580 ENSDORP00000001580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]