SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001585 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001585
Domain Number 1 Region: 217-427
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.33e-52
Family Reprolysin-like 0.0045
Further Details:      
 
Domain Number 2 Region: 518-574
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000183
Family TSP-1 type 1 repeat 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001585   Gene: ENSDORG00000001696   Transcript: ENSDORT00000001696
Sequence length 695
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3517:47362:54471:-1 gene:ENSDORG00000001696 transcript:ENSDORT00000001696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSWMGLHPRRGLARCWLLRAEFRLLLHSVPRSLPLWLLLPLLASLLPSAWPASPLPREEE
IVFPERLNGSVLPGSGSPARLLYRLPAFGEMLLLELEQDPGVQVEGLTVQYLGQAPELLG
GAEPGTYLTGTINGDLESVASLHWDGRALLGVLQYRGAELHLQPLEGSTLNSAGGPGAHI
LRRKSPASDQGPMCSVKAPLESPSPSPRRAKRFASLSRFVETLVVADDKMAAFHGAGLKR
YLLTVMAAAAKAFKHPSIRNPVSLVVTRLVILGSGEEGPQVGPSAAQTLRSFCAWQRGLN
TPEDSDPDHFDTAILFTRQDLCGVSTCDTLGMADVGTVCDPARSCAIVEDDGLQSAFTAA
HELGHVFNMLHDNSKQCVSWNGHGSTSRHVMAPVMAHVDPEELWSPCSARFITNFLDDGY
GHCLLDKPEAPLHLPVTFPGKDYDADRQCQLTFGPDSHHCPQLPPPCAALWCSGHLNGHA
MCQTKHSPWADGTPCGPAQACMGGRCLHVDQLKDFNVPQAGGWGAWGPWGDCSRSCGGGV
QFSSRDCTKPVPRNGGKYCEGRRTRFRSCNTKNCPTGTALTFREEQCAAYNHRTDLFKSF
PGPMDWVPRYAGVAPQDQCKLTCQARALGYYYVLEPRVVDGTPCSPDSTSVCVQGRCIHA
GCDRIIGSKKKFDKCMVCGGDGSGCSKQSGSFRKF
Download sequence
Identical sequences ENSDORP00000001585 ENSDORP00000001585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]