SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001621 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001621
Domain Number 1 Region: 214-459
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.98e-77
Family Leukotriene A4 hydrolase catalytic domain 0.000000000358
Further Details:      
 
Domain Number 2 Region: 13-208
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 1.83e-52
Family Leukotriene A4 hydrolase N-terminal domain 0.00000000717
Further Details:      
 
Domain Number 3 Region: 462-609
Classification Level Classification E-value
Superfamily ARM repeat 1.55e-45
Family Leukotriene A4 hydrolase C-terminal domain 0.000000124
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001621   Gene: ENSDORG00000001735   Transcript: ENSDORT00000001734
Sequence length 610
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3306:67313:101658:-1 gene:ENSDORG00000001735 transcript:ENSDORT00000001734 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAVVDSCSLASPASVCQTKHLHLRCSVDFARRVLAGTAALTVQSREDNLRSLVLDTKDL
TIEKVVINGQEVKYTLGERQSYKGSPMEISLPIALSKNQEVVIEITFETSPKSSALQWLT
PEQTSGKKHPYLFSQCQAIHCRAILPCQDTPSVKLTYSAEVSVPKELVALMSAIRDGDAP
DPEDPSRKIYKFNQKVPIPCYLIALVVGALESRQIGPRTLVWSEKEQVEKSAYEFSETES
MLKIAEDLGGPYVWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLAGDKSLSNVIAHEISH
SWTGNLVTNKTWDHFWLNEGHTVYLERHICGRLFGEKFRHFHALGGWGELQNSIKTFGET
HPFTKLVVDLKDVDPDVAYSSVPYEKGFALLFYLEQLLGGPEVFLGFLKAYVEKFSYKSI
TTDDWKNFLYSHFKDKVDVLNQVDWNAWLYSPGLPPVKPNYDMTLTNACIALSQRWITAK
EEDLSSFNAADLKDLSSHQLNEFLAQMLQRAPLPLGHIKRMQEVYNFNAINNSEIRFRWL
RLCIQSKWEEAIPLALKMATEQGRMKFTRPLFKDLAADKSHDQAIRTYQEHKASMHPVTA
MLVGRDLNVD
Download sequence
Identical sequences ENSDORP00000001621 ENSDORP00000001621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]