SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001623 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001623
Domain Number 1 Region: 384-666
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.1e-68
Family WD40-repeat 0.0000244
Further Details:      
 
Domain Number 2 Region: 243-336
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0000000000144
Family SIAH, seven in absentia homolog 0.012
Further Details:      
 
Domain Number 3 Region: 180-251
Classification Level Classification E-value
Superfamily TRAF domain-like 0.000000000222
Family SIAH, seven in absentia homolog 0.0048
Further Details:      
 
Domain Number 4 Region: 128-170
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000631
Family RING finger domain, C3HC4 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001623   Gene: ENSDORG00000001727   Transcript: ENSDORT00000001736
Sequence length 667
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5077:20713:31975:1 gene:ENSDORG00000001727 transcript:ENSDORT00000001736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLGESARSNCLSGGPASLPSPDLSGGTKMETTFGPTFSAVTTITKADGASTYKQHRRTP
SSSSTLAFSPRDEEDSMPPISTPRRSDSAISVRSLHSESSMSLRSTFSLPEEEEELEPLV
FAEQPSVKLCCQLCCSVFKDPVITTCGHTFCRRCALKSEKCPVNAKLTVVNNIAVEHHGE
LFIHCRHGCRATGAGKPSVFEVDPRGCPFTIKLSARKDHESSCDYRPVHCPNNPSCPPLL
KMNLEAHLRECEHIKCPHSKYGCTFIGNQDTYETHLESCRFEGLKEFLQQTDDRFHEMHV
ALAQKDQEIAFLRSMLGKLSEKIDQLEKSLELKFDVLDENQSKLSEDLMEFRRDASMLND
ELSHINARLNMGILGSYDPQQIFKCKGTFVGHQGPVWCLCVYSMGDLLFSGSSDKTIKVW
DTCTTYKCQKTLEGHDGIVLALCIQGCKLYSGSADCTIIVWDIQNLQKVNTIRAHDNPVC
TLVSSHNMLFSGSLKAIKVWDIVGTELKLKKELTGLNHWVRALVAAQSYLYSGSYQTIKI
WDIRTLDCIHVLQTSGGSVYSIAVTNHHIVCGTYENLIHVWDIESKEQVRTLTGHVGTVY
ALAVISTPDQTKVFSASYDRSLRVWSMDNMICTQTLLRHQGSVTALAVSRGRLFSGAVDS
TVKVWTC
Download sequence
Identical sequences ENSDORP00000001623 ENSDORP00000001623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]