SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001625 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001625
Domain Number 1 Region: 11-192
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.38e-38
Family Laminin G-like module 0.002
Further Details:      
 
Domain Number 2 Region: 248-314
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000101
Family VWC domain 0.012
Further Details:      
 
Domain Number 3 Region: 461-565
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000377
Family Growth factor receptor domain 0.0094
Further Details:      
 
Domain Number 4 Region: 663-735
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000711
Family VWC domain 0.025
Further Details:      
 
Domain Number 5 Region: 408-451
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000794
Family EGF-type module 0.014
Further Details:      
 
Domain Number 6 Region: 570-612
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000013
Family EGF-type module 0.02
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000001625
Domain Number - Region: 746-783
Classification Level Classification E-value
Superfamily FnI-like domain 0.0544
Family VWC domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001625   Gene: ENSDORG00000001739   Transcript: ENSDORT00000001738
Sequence length 791
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1044:3902:675693:1 gene:ENSDORG00000001739 transcript:ENSDORT00000001738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGFGMDPDLQMDIISELDLVNTTFGVTQVSGLHNASKAFLFQDIDREVHAAPHVSEKLIQ
LFRNKSDFTFLATVQQKPSTSGVILSIRELEHSYFELESSGLRDEIRYHYIHNGKVKTEA
LPYRMADGQWHKVSLSVSASHLLLHVDCNRIYERVIDPPETNFPPGSSLWLGQRNQKHGF
FKGIIQDGKIIFMPNGYITQCPNLNRXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNYAET
RLSQLENCHCEKTCQVSGLLYRDQDSWVDGDQCRNCTCKSGSVECRRMSCPPLNCSSDSL
PVHIAGQCCKVCRPXXXXXXXXXXXXXXXXXXXXXXXXGGVLVKITEMCPPLNCSEKDHI
LPENQCCSVCRXXXXXXXXXXXXXXXXXXXXXXXATCECKNGYISIQGDSAYCEDIDECA
AKMHYCHANTVCVNLPGLYRCDCVPGYIRVDDFSCTEHDECGSGQHNCDENAICTNTVQG
HSCTCKPGYVGNGTVCRAFCEEGCRYGGTCVAPNKCLCPPGFTGSHCEKDIDECTEGIIE
CHNHSRCVNLPGWYHCECRSGFHDDGTYSLSGESCIDIDECALRTHTCWNDSACINLAGG
FDCLCPSGPSCSGDCPHEGGLKRNGQVWTLREDRCSVCSCKDGKIFCRRTACDCQNPSVD
LFCCPECDTRVTSQCLDQSGHKLYRSGDNWTHSCQQCRCLEGEVDCWPLTCPNLSCEYTA
MLEGECCPHCVSDPCLADNMVYDIRKTCLDSNGVSRLSDAVWTMTGSPCTTCKCKNGRVC
CSVDLECLQNN
Download sequence
Identical sequences ENSDORP00000001625 ENSDORP00000001625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]