SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001653 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001653
Domain Number 1 Region: 8-188
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.49e-31
Family Ankyrin repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001653   Gene: ENSDORG00000001767   Transcript: ENSDORT00000001766
Sequence length 190
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_6804:34925:49605:-1 gene:ENSDORG00000001767 transcript:ENSDORT00000001766 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGILYSEPICQAAYQNDLGQVWQWVKTDNNYINIQDGFNGDTPLICCRRGHVRIVSFLLK
RNANVNLKNQKERTCLHYAVKKRFTFFDYLLIVLLMPVLLIGYFLMVSKTKQNEYLVRML
LDAGVEVNATDCYGCTALHYACKMKNQALIPLLLQAHADPMIKNKEGESSLDIVKKLKFS
QIELMLRKAS
Download sequence
Identical sequences ENSDORP00000001653 ENSDORP00000001653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]