SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001674 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001674
Domain Number 1 Region: 7-236
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.52e-70
Family Eukaryotic proteases 0.0000000889
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001674   Gene: ENSDORG00000001790   Transcript: ENSDORT00000001787
Sequence length 238
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_15170:30532:33707:1 gene:ENSDORG00000001790 transcript:ENSDORT00000001787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGRSRAQGSKILEGQECKPHSQPWQAGLFQGQRLICGGVLVGTNWVLTAAHCKKMKYTVR
LGDHSLQSRNEGEQEMYVARSIQHPCYNNSNPEDHSHDLMLIRLRKQADLGPTVKPIDLA
YHCTHQGQKCTISGWGTVTSPQENFPDTLNCANVEIFSQKKCEEAYPGKINDGXXXXXXX
XXXXXXXGDSGGPLVCGGVLQGITSWGSDPCGRPERPGVYTNLCRYHDWMKKTMGNRD
Download sequence
Identical sequences ENSDORP00000001674 ENSDORP00000001674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]