SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001679 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001679
Domain Number 1 Region: 1383-1640
Classification Level Classification E-value
Superfamily YWTD domain 4.05e-57
Family YWTD domain 0.00000311
Further Details:      
 
Domain Number 2 Region: 777-1027
Classification Level Classification E-value
Superfamily YWTD domain 6.93e-52
Family YWTD domain 0.00000227
Further Details:      
 
Domain Number 3 Region: 1079-1331
Classification Level Classification E-value
Superfamily YWTD domain 1.24e-47
Family YWTD domain 0.00000306
Further Details:      
 
Domain Number 4 Region: 601-731
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-30
Family YWTD domain 0.0000538
Further Details:      
 
Domain Number 5 Region: 389-467,723-771
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000267
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 6 Region: 309-346
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000288
Family LDL receptor-like module 0.00065
Further Details:      
 
Domain Number 7 Region: 1337-1382
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000128
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 8 Region: 1033-1084
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000262
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000001679
Domain Number - Region: 1640-1677
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00118
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001679   Gene: ENSDORG00000001785   Transcript: ENSDORT00000001794
Sequence length 1930
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2907:14684:64919:-1 gene:ENSDORG00000001785 transcript:ENSDORT00000001794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGALLLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXTSMCTAEQFRCQSGRCVRLSWRCDGEDDCADNSDEENCENTGPQCASDFLCG
RCIGQLCGVDCGDNSXXXXXXXXXPRTGEENCSVNNGGCAQKCQMVRGAVQCTCHTGYRL
TEDGRTCQDVNECAEEGYCSQGCTNSEGAFQCWCETGYELRPDRRSCKALGPEPVLLXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNGSNVEEVV
STGLESPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
TIYWTDWGNTPRIEASSMDGSGRHIIADTHLFWPNGLTIDYAGRRMYWVDAKHHVIERAN
LDGSHRKAVISQGLPHPFAITVFEDSLYWTDWHTKSINSANKFTGKNQEIIRNKLHFPMD
IHTLHPQRQPAGKNRCGDNNGGCTHLCLPSGQNYTCACPTGFRKINSHACAQSLDKFLLF
ARRMDIRRISFDTEDLSDDVIPLADVRSAVALDWDSRDDHVYWTDVSTDTISRAKWDGTG
QEVVVDTSLESPAGLAIDWVTNKLYWTDAGTDRIEVANTDGSMRTVLIWENLDRPRDIVV
EPMGGYMYWTDWGASPKIERAGMDASARQVIISSNLTWPNGLAIDYGSQRLYWADAGMKT
IEFAGLVLIGSQLPHPFGLTLYGERIYWTDWQTKSIQSADRLTGLDRETLQENLENLMDI
HVFHRQRPPVTTPCAMENGGCSHLCLRSPNPSGFSCTCPTGINLLPGGKTCSPGMNSFLI
FARRIDVRMVSLDIPYFADVVLPINVTMKNTIAIGVDPQEGKVYWSDSTLHRISRASLDG
SQHEDIITTGLQTTDGLAVDAIGRKVYWTDTGTNRIEVGNLDGSMRKVLVWQNLDSPRAI
VLYHEMGFMYWTDWGENAKLERSGMDGSDRTVLINNNLGWPNGLTVDKASSQLLWADAHT
ERIEAADLNGANRHTLVSPVQHPYGLTLLDSYIYWTDWQTRSIHRADKGTGSNVILVRSN
LPGLMDIQAVDRTQPLGFNKCGLRNGGCSHLCLPRPSGFSCACPTGIQLKGDGKTCDHSP
ETYLLFSSRGSIRRISLDTSDHTDVHVPVPELNNVISLDYDSVDGKVYYTDVFLDVIRRA
DLNGSNMETVIGRGLKTTDGLAVDWVARNLYWTDTGRNTIEASRLDGSCRKVLINNSLDE
PRAIAVFPRKGYLFWTDWGHIAKIERANLDGSERKVLINTDLGWPNGLTLDYDTRRIYWV
DAHLDRIESADLNGKLRQVLVSHVSHPFALTQQDRWIYWTDWQTKSIQRVDKYSGRNKET
VLANVEGLMDIIVVSPQRQTGTNACGVNNGGCTHLCFARALDFVCACPDEPDSRPCSLVP
GLVPPAPRATSMSEKSPVLPNTLPTTLHSSTIRTRTSLEEVGGXXXXXXXXXXXXXXXXX
XXXXXXXEGLHISYAIGGLLSILLILVVIAALMLYRHKKSKFTDPGMENLTYSNPSYRTS
TQEVKEAIPKALYNQLYKKEGGPDHNYTKEKIKIVEGICLLSGDDAEWDDLKQLRSSRGG
LLRDHVCMKTDTVSIQASSGSLDDTEREQLLQEEQSECSSVHTAATPERRGSLPDTGWKH
ERKLSSESQV
Download sequence
Identical sequences ENSDORP00000001679 ENSDORP00000001679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]