SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001718 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001718
Domain Number 1 Region: 623-833
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.16e-50
Family Ankyrin repeat 0.00011
Further Details:      
 
Domain Number 2 Region: 80-284
Classification Level Classification E-value
Superfamily VPS9 domain 2.48e-40
Family VPS9 domain 0.0013
Further Details:      
 
Domain Number 3 Region: 346-375,408-425,492-555
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000481
Family Ankyrin repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001718   Gene: ENSDORG00000001832   Transcript: ENSDORT00000001833
Sequence length 990
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1405:3698:34570:-1 gene:ENSDORG00000001832 transcript:ENSDORT00000001833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FESYLLIPAEGHFQTFDGKDVFIQGNRIKLGAGFSCLLPVPILFEETFYNEKEESFSILC
IAHPLEKRGGPEEPSVPSDPFFLKTIEDVREFLGRHSERFDKNIACFHRTSRECDRKSLR
HLIDSVNALYTKCLQQLLRDSHLKVLAKQEAQMNLMKQAVEMYVHHATYDRIFKSVGTME
ASEDAAFNKITRSLQDLQQKDLGVKPEFSFNIPRAKRELAQLNKCTSPQQKLLCLRKVIQ
LITQSPSHRVNLETMCADDLLSVLLYLLVKTEIPNWMANLSYMKSSXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXESEGLGDRLFLKQKMNFLSQMASTPTDCLFKHIASGNQKE
VEKLLSQQDCDRDVIQKMCHPLCFCDDCEKLVSGRMNDPSVVTPFSRDDSGYTPLHMAAL
CXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXCVKALVYYDAQLCRLDISNEKGDTPLHIAARWGYQGIIETLLQNGAPTD
VQNRMKETPLQCALNAKXXXXXXXXXXXXXXXXXXXXVPSQSPQRSMDSISQDSSTSSFS
SALVSSRQEEAKKDFREVEKLRAVADGDLEMVRYLLEWTEEDLDEADDAVGVAGVEFCHP
LCQCPKCAPAQKKLAKVPASGLGVNVTNQDGASPLHVAALHGRADLVLLLLKHGASPSAR
DKAQATPLHLACRKGHFEVVKCLLDSNVKPDKKDLSGNTPLICACAEGHHEVAALLLQHG
ASMNASNSKGNTALHEAVIGNHVFVVELLLLHGASVHIMNKRQRTAIDCADQKSKIMELL
QVVPSCVTSLDDVSESDAGEYVTVKIRKKWSSTLYDLPDEPFTRQFYCGPSVGGSEKKTS
KEIMARGRSVPNFTEPERQGVTGKQSHPPAQAAADRGDEGPAQSAGLRPAVPAPEGVIHR
GTVNDTPDLQTPETLGQPATSPEPSLSPSK
Download sequence
Identical sequences ENSDORP00000001718 ENSDORP00000001718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]