SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001752 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001752
Domain Number 1 Region: 41-269,368-514
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.57e-63
Family FAD-linked reductases, N-terminal domain 0.00000000000318
Further Details:      
 
Domain Number 2 Region: 270-368
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.65e-37
Family Electron transfer flavoprotein-ubiquinone oxidoreductase-like 0.000000853
Further Details:      
 
Domain Number 3 Region: 516-615
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.81e-28
Family ETF-QO domain-like 0.00000214
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001752   Gene: ENSDORG00000001865   Transcript: ENSDORT00000001867
Sequence length 617
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6647:9735:40360:1 gene:ENSDORG00000001865 transcript:ENSDORT00000001867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVSLAKLSCPAYHCFHALKFNKSYLPVCATRWSSTSIAPQITTHYTIYPRDKDKRWEGV
NMERFAEEADVVIVGAGPAGLSAAIRLKQLAAEHEKDIRVCLVEKAAQIGAHTLSGACLD
PGAFKELFPDWKEKGAPLNTPVTEDRFGILTEKYRIPVPILPGLPMNNHGNYIVRLGHLV
SWMGEQAEALGVEVYPGYAASEVLFHEDGSVKGIATNDVGIQKDGAPKTTFERGLELHAK
VTIFAEGCHGHLAKQLYKKFDLRSNCDPQTYGIGLKELWIIDEKKWKPGRVDHTVGWPLD
RHTYGGSFLYHLNEGEPLVALGFVVGLDYQNPYLSPFREFQRWKHHPSVQPTLEGGKRIA
YGARALNEGGFQSIPKLTFPGGLLIGCSPGFMNVPKIKGTHTAMKSGSLAAESIFNQLTS
ENLQSKTLGLHITDYEDNLKKSWVWKELYAVRNIRPSCHGILGVYGGMIYTGVFYWILRG
MEPWTLKHKGSDSDQLKPAKDCTPIEYPKPDGQISFDLLSSVALSGTNHEHDQPAHLTLK
DDSVPVNRNLSIYDGPEQRFCPAGVYEFVPLEQGDGYRLQINAQNCVHCKTCDIKDPSQN
INWVVPEGGGGPAYNGM
Download sequence
Identical sequences A0A1S3GB92
XP_012885292.1.60039 ENSDORP00000001752 ENSDORP00000001752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]