SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001774 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001774
Domain Number 1 Region: 359-556
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.7e-68
Family Hemopexin-like domain 0.00000955
Further Details:      
 
Domain Number 2 Region: 143-301
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.56e-48
Family Matrix metalloproteases, catalytic domain 0.000000927
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001774   Gene: ENSDORG00000001890   Transcript: ENSDORT00000001890
Sequence length 669
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_530:108038:122534:1 gene:ENSDORG00000001890 transcript:ENSDORT00000001890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSDRGAPARPGGFRGGREAAARPRLLPLLLVLLGCLSRRTVAEDAEVHAEXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXIQNYTEKLGWYHSLEAVRRAFQVWEQATPLAFEEVP
YDDIQLRRQKEADIMVLFASGFHGDSSPFDGTGGFLAHAYFPGPGLGGDTHFDADEPWTY
SSTDLHGNSLFLVAVHELGHALGLEHSSNPSAIMAPFYQWMDTDNFQLPEDDLRGIQQLY
GTPDGQPHPTRPLPTVTPRQPGRPDQRPPRPPQPPPPGGKPDRPPKPGPPVQPRATERPD
QYGPNICDGNFDTVAMLRGEMFVFKGRWFWRVRHNRVLDNYPMPIGHFWRGLPGDISAAY
ERQDGRFVFFKGDRYWLFREANLEPGYPQPLTSYGLGIPYDRIDTAIWWEPTGHTFFFQE
DRYWRFNEETQHGDPGYPKPISVWQGVPISPKGAFLSSDAAYTYFYKGTKYWKFDNERLR
MEPGYPKSILRDFMGCQEHVDTGPRWPDVARPPFNPDGDAQPGVDGDSTDGTVGGGAGED
RDRDKDKEGGTRVVVQMEEVARTVNVVMVLVPLLLLLCVLGLAFALVQLQRKGAPRVLLY
CKRSLQEWV
Download sequence
Identical sequences ENSDORP00000001774 ENSDORP00000001774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]