SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001823 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001823
Domain Number 1 Region: 27-199
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-38
Family SPRY domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001823   Gene: ENSDORG00000001946   Transcript: ENSDORT00000001942
Sequence length 204
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5615:6654:7629:1 gene:ENSDORG00000001946 transcript:ENSDORT00000001942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPLARLCRWGAKRWGAAAGEARRGVSFKLEEKTAHSSLALFKKDTGVKYGLVGLEPTQ
VALNVERFREWAVVLADTAVTNGRHYWEVTVKRSQQFRIGVADVDMSRDSCIGVDDRSWV
FSYAQRKWHTMLANEKAPIEGIGQPEKVGLLLEYEAKKLSLVDVSQVSVIHTLQTDFRGP
VVPAFALWDGELLTHSGLEVPEGL
Download sequence
Identical sequences A0A1S3FPJ2
ENSDORP00000001823 XP_012878478.1.60039 ENSDORP00000001823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]