SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001903 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001903
Domain Number 1 Region: 325-476
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-42
Family SPRY domain 0.00014
Further Details:      
 
Domain Number 2 Region: 40-151
Classification Level Classification E-value
Superfamily Immunoglobulin 8.88e-17
Family V set domains (antibody variable domain-like) 0.00032
Further Details:      
 
Domain Number 3 Region: 163-243
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000022
Family C1 set domains (antibody constant domain-like) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001903   Gene: ENSDORG00000002028   Transcript: ENSDORT00000002029
Sequence length 478
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6887:3492:12307:1 gene:ENSDORG00000002028 transcript:ENSDORT00000002029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANIPESLEFLKQVLLPSRVFFLIHLLLLPQPGQVNSEVMVIGPGEPILAHVGEEVEFSC
HLSPYQDAKHMEIRWFRSQASDVVHLYPEPQELWAQQMTQFQNRTRLVTEEIADGSVNLY
LRGVLPSDEGPYGCSFLSDSFSGEALWELEVAGHGSDPHISLEGFKEGGIQLRCSSSGWY
PKPTVQWSDHQGQCLPPESKIIIQDAQGLFSLETSVVVRKGAHSNVSCSIQNPLLMQKKE
FVVQIADVFLPGTSPWKRAFLGTLVTLLLLVALLTLLATRYFRRQRQFQAKVKKQADKER
XXXXXXXXXXXXXXXXXXXXXXXXXXDITLDPATAHPSLEVSKDGKSVSSSRGPRTPASC
DPSRFSEQTCVLSHERFPSGRHYWEVHVGSRSRWFLGACLDSVARSGHARLSPARGYWVM
GLWNGCEYFVLDPHRVALPVRVPRRVGIFPNCEVGKLSFFGRAEGSHLYIFQNTFFGA
Download sequence
Identical sequences ENSDORP00000001903 ENSDORP00000001903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]