SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001925 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001925
Domain Number 1 Region: 133-329
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.5e-37
Family Reprolysin-like 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001925   Gene: ENSDORG00000002055   Transcript: ENSDORT00000002056
Sequence length 686
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1387:20361:51767:-1 gene:ENSDORG00000002055 transcript:ENSDORT00000002056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISYSIMIEGKTYTMHLKQKPFLPRSFKVYSYDGSGIMMPLDEDIESSCHYQGYLEGYPNS
MATLSTCTGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXAQKDLPHYIEMHIVVEKRLYDHMGSDTTIVTEKIFQLIVLTNAIFASINLNII
LSSLEFWTDENKISTSGNANELLHKFLKWKRSFLVLRPHDMAFLLXXXXXXXXXXXXXXX
XXXXXXXXXXXXXHPRIISLESLAIILVQLLSFSMGISYDDLSKCHCPGAVCIMNPEAIH
ASGTKTFSNCSLEDYALFLASPMSHCLQNQPHLQPSYKTDAVCGNGIVEKGEACDCGSKM
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXNRKCEKIVCRYRGXXXXXXXXXXXXXXNASGQVCVSLEFSDHNEWQ
KMWVNNGTICNAQKVCRNKECVENSYLNYDCTPQNCNNRGVCNNKKNCHCEAKYLPPNCA
NTNEDWPGGSINSGNHPMEVPSGRQYFESVYHPKPPRWPFFLIIPFFIILCILIVMLVKL
YFQRKNWKTDDYLSDEQIGSESETRE
Download sequence
Identical sequences ENSDORP00000001925 ENSDORP00000001925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]