SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001974 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001974
Domain Number 1 Region: 269-408
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 6.21e-58
Family P-domain of calnexin/calreticulin 0.0000000384
Further Details:      
 
Domain Number 2 Region: 61-176
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.85e-29
Family Calnexin/calreticulin 0.00000332
Further Details:      
 
Domain Number 3 Region: 410-455
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000206
Family Calnexin/calreticulin 0.00015
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000001974
Domain Number - Region: 241-269
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00934
Family Calnexin/calreticulin 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001974   Gene: ENSDORG00000002108   Transcript: ENSDORT00000002108
Sequence length 591
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2507:14474:28849:1 gene:ENSDORG00000002108 transcript:ENSDORT00000002108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGRWLLYMLLVLGTAIIQAHDGHDDDMIDIEDDLDDVIEEVEDSKSKPDTSTPPSPKVT
YKAPVPTGEVYFADSFDRGSLSXXXXXXXXXXXXXXXXXXXKWEVDEMKETKLPGDKGLV
LMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
LNPDNTFEILVDQSVVNSGNLLNDMTPAVNPSREIEDPEDRKPEDWDERPKIPDPDAVKP
DDWDEDAPAKIPDEEATKPDGWLDYELEYIPDPDAEKPEDWDEDMDGEWEAPQIANPKCE
SAPGCGVWQRPMIDNPNYKGKWKPPMIDNPNYQGIWKPRKIPNPDFFEDLEPFRMTPFSA
IGLELWSMTSDIFFDNFIISGDRRVVDDWANDGWGLKKAADGAAEPGVVGQMLEAAEERP
WLWVVYILTVALPVFLVILFCCSGKKQSNAMEYKKTDAPQPDVKEEEEEKEEEKDKGDED
EEGEEKLEEKQKSDAEEDGGTVSQEEEDRKPKAEEDEVLNRSPRNRKPRRE
Download sequence
Identical sequences ENSDORP00000001974 ENSDORP00000001974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]