SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002003 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002003
Domain Number 1 Region: 24-266,303-381,497-547
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.04e-65
Family FAD-linked reductases, N-terminal domain 0.0017
Further Details:      
 
Domain Number 2 Region: 361-484
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 5.63e-31
Family L-aminoacid/polyamine oxidase 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002003   Gene: ENSDORG00000002138   Transcript: ENSDORT00000002138
Sequence length 555
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_12999:1575:15318:-1 gene:ENSDORG00000002138 transcript:ENSDORT00000002138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSCESSVDSADDSLSRGLRRRGQPRVVVIGAGLAGLAAAKALLEQGFTDVTVLEASSHI
GGRVQSVKLGRATFELGATWIHGSHGNPIYHLAEANGLLEETTDGERSVGRISLYSKNGV
VCYLTNHGHRIPKDVVEEFSDLYDEVYNLTQEFFRHGKPVNAESENSVGVFTREEVRNRI
RDDPDDPEATKRLKLAMIQQYLKVESCESSSHSIDEVSLSAFGEWTEIPGAHHIIPSGFM
RVVELLAEGIPANVIQLGKPVRCIHWDQASAHPRGPEIEPRRKGDHNHYSGEGGQRGEGP
QGEGWGDEEPWPVAVECEDCEVIPADHVIVTVSLGVLKRQYTSLFQPSLPTEKVAAIHRL
GIGTTDKIFLEFEEPFWGPECNSLQFVWEDEAESRTLTYPPELWYRKICGFDVLYPPERY
GHVLSGWICGEEALVMEKCDDEAVAEICTEMLRQFTGDPNIPKPRRILRSAWGSNPYFRG
SYSYTQVGSSGADVEKLAKPLPYTESSKTAPMQVLFSGEATHRKYYSTTHGALLSGQREA
ARLIEMYRDLFQQGP
Download sequence
Identical sequences ENSDORP00000002003 ENSDORP00000002003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]