SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002007 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002007
Domain Number 1 Region: 14-183
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.28e-43
Family Prokaryotic proteases 0.00000287
Further Details:      
 
Domain Number 2 Region: 239-321
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000171
Family HtrA-like serine proteases 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002007   Gene: ENSDORG00000002142   Transcript: ENSDORT00000002142
Sequence length 324
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5278:528:12822:1 gene:ENSDORG00000002142 transcript:ENSDORT00000002142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LHQLTSPRFKFNFIADVVEKIAPAVVHIDLFLRHPLFGNNAPLSSGSGFIMSETGLIVTN
AHVVSSANTVSGRQQLKVQLQSGDSYEASIKDIDTTSDIATIKIHPKKKLPVLLLGRSAD
LRPGEFVVAIGSPFALQNTVTTGIVSTTQRDGKQLGLHHSDMDYIQTDAIINYGNSGGPL
VNLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLV
EELKASNPDFPSVSSGIYVQEVAPNSPSQRGGIQDGDVIVRVNGRALLDSSELQEAVLTE
SPLLLEVRRGNDDLLFNISPEVVM
Download sequence
Identical sequences ENSDORP00000002007 ENSDORP00000002007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]