SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002055 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002055
Domain Number 1 Region: 129-336
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.9e-53
Family Ankyrin repeat 0.00024
Further Details:      
 
Domain Number 2 Region: 657-782,809-943
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.14e-49
Family Ankyrin repeat 0.00024
Further Details:      
 
Domain Number 3 Region: 364-556
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.07e-48
Family Ankyrin repeat 0.00082
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000002055
Domain Number - Region: 44-77
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00906
Family Ankyrin repeat 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002055   Gene: ENSDORG00000002191   Transcript: ENSDORT00000002190
Sequence length 1084
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6688:11749:81749:-1 gene:ENSDORG00000002191 transcript:ENSDORT00000002190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRVCIVVLEEVEDDSPEFISKLPQENKSLHSSPSGNVLVRFPSLVQAIFNGDPDEVRAL
IFKKEDVNFQDNEKRTPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHA
AFSGHAEXXXXXXXXXXXXXXXXXXXXXXXHWAAYMGHIEVVKLLVAHGAEVTCKDKKSY
TPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANVNQ
KNEKGFTPLHFAAASTHGALCLELLVGHGADVNMKXXXXXXXXXXXXXXXXXXXXXXXXX
XXAIIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDC
CRKLLSLGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNRKDKFGRTLHYAAAN
CNYQCLFAVGSGASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAV
HYSAAYGHRLCLQLIASETPLDVLMETSGTDMLNDSDNRATVSPLHLAXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTNGH
SECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTA
LHRGAVTGHEECIDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXHDTCVELLLEQEVFQKIEGNAFSPLHCAVINDNEGAAEMLID
TLGASIVNATDSKGRTSLHAAAFTDHVECLQLLLSHNAQVNSVDSSGKTPLMMAAENGQT
NTVEMLVSSASADLTLQDNCKNTALHLACGKGHETSALLILEKITDRNLINATNAALXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYTPALACAPNKDVADCLALILATMMPVSST
SPLSSLTFNAINRYTNTSKTVSFEALPIMRNEPSSYCSFNNITGEQEYLYTDVDELNDSD
SETY
Download sequence
Identical sequences ENSDORP00000002055 ENSDORP00000002055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]