SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002056 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002056
Domain Number 1 Region: 254-324
Classification Level Classification E-value
Superfamily Homeodomain-like 2.65e-20
Family Homeodomain 0.0022
Further Details:      
 
Domain Number 2 Region: 97-165
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000404
Family LIM domain 0.016
Further Details:      
 
Domain Number 3 Region: 65-96
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000291
Family LIM domain 0.0076
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000002056
Domain Number - Region: 161-191
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0026
Family LIM domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002056   Gene: ENSDORG00000002192   Transcript: ENSDORT00000002191
Sequence length 397
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_4256:8364:20086:-1 gene:ENSDORG00000002192 transcript:ENSDORT00000002191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIVGCRAEDNSCPFRPPAMLFHGISGGHIQGIMEEMERRSKTEARLAKGAQLNGRDAGM
PPLSPEKPALCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYC
KEDYYRRFSVQRCARCHLGISASEMVMRARDSVYHLSCFTCSTCNKTLTTGDHFGMKDSL
VYCRAHFESLLHGEYPPPLSYTELAAKSGGLALPYFNGTGTVQKGRPRKRKSPALGVDIV
NYSSGCNENEADHLDRDQQPYAPSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQL
AQKTGLTKRVLQVWFQNARAKFRRNLLRQENGGVDKADGSSLPAPPSADSGGLTPPGTAT
TLTDLTNPTLTVVTAVTSSLDSHQPGSPPQTTLTNLF
Download sequence
Identical sequences A0A1S3F854
ENSDORP00000002056 ENSDORP00000002056 XP_012872843.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]