SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002059 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002059
Domain Number 1 Region: 763-817
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000893
Family Laminin-type module 0.0000536
Further Details:      
 
Domain Number 2 Region: 659-710
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000893
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 3 Region: 221-279
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000446
Family Laminin-type module 0.037
Further Details:      
 
Domain Number 4 Region: 870-920
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000307
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 5 Region: 819-867
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000698
Family Laminin-type module 0.0003
Further Details:      
 
Domain Number 6 Region: 382-432
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000642
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 7 Region: 333-382
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000265
Family Laminin-type module 0.0079
Further Details:      
 
Domain Number 8 Region: 277-335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000254
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 9 Region: 708-765
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000335
Family Laminin-type module 0.00021
Further Details:      
 
Domain Number 10 Region: 1223-1463
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000569
Family Tropomyosin 0.0014
Further Details:      
 
Domain Number 11 Region: 918-963
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000201
Family Laminin-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000002059
Domain Number - Region: 1012-1211
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.000235
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0089
Further Details:      
 
Domain Number - Region: 622-661
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0642
Family Laminin-type module 0.062
Further Details:      
 
Domain Number - Region: 36-107
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.085
Family Galactose-binding domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002059   Gene: ENSDORG00000002195   Transcript: ENSDORT00000002195
Sequence length 1544
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3007:7897:124145:1 gene:ENSDORG00000002195 transcript:ENSDORT00000002195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ATNTCEIPHEEYFVQTGGTGVTKSCHLDAGQPHLQHGAAFLTEYNNQADTTWWQSQTMLA
GVQYPNSINLTLHMGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWGPYQYYSGSCENT
YSKANRGFIRTGEDEQQPLCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQEWVT
ATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECVKNEYDKLVC
NCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCNGRSQECYFDPELYRSTGHGG
HCTNCQDNTDGANCERCRENFFRLGNNEACSPCHCSPVGSLSTQCDSYGRCSCKPGVMGD
KCDRCQPGFHSLTEAGCRPCSCDPSGSTDECNAETGRCVCKDNVEGFNCERCKPGFFNLE
ASNPRGCTPCFCFGHSSVCTNAVGFSAYTISSAFHTDEDGWRVEQRDGSEASLDWSSERR
DIAVISDSYFPRYFIAPAKFLGNQVLSYGQNFSFSFRVDRRDTRLSAEDLVLEGAGLRVS
VPLIAQGNSYPSETTVKYTFRLHEATDYPWRPTLSPFEFQKLLNNLTSIKIRGTYSERNT
GYLDDVTLASARPGPGVPATWVESCTCPVGYGGQFCETCLPGYRRETPSLGPYSPCVLCT
CNGHSETCDPETGVCNCRDNTAGPHCEKCSDGFYGDSTAGTNSDCQPCPCPGGSSCAVVP
KTKEVVCTNCPTGTTGKRCELCDDGYFGDPLGSNGPVRLCRLCQCNDNIDPNAVGNCNRL
TGECLKCIYNTAGFYCDRCKEGFFGNPLAPNPADKCKACSCNPYGTMRQQSNCNSVTGQC
ECLPHVSGRDCSACDPGFYNLHSGQGCERCDCHALGSTNGQCDIRTGQCECQPGITGQHC
ERCEVNHFGFGPEGCKPCDCHPEGSLSLQCKDDGRCECREGFVGNRCDQCEENYFYNRSW
PGCQECPACYRLVKDKVADHRVKLQELESLIANLGTGDEMVTDQAFEDRLKEAEREVMDL
LREAQDVKDVDQNLMDRLQRVNNTLYSQISRLQNIRNIIEETGNLAEQARTRVQNTEQLI
EIASRELEKAKVAVANVSITQPESTGDPNNMTLLAEEARKLAERHKQEADDIVRVAKTAN
DTSTEAYNLLLRTLAGENQTAFEIEELNRKYEQVKNISQDLEKQAAQVHAEAKRAGDRAV
EIYASVAQLSPVDSVALENEANKIKKEAEDLDRLIDQKLKDYEDLREDMRGKEAEVQDLL
EKGKVEQQTADQLLARADAAKALAEEAAKKGQNTLQEARDILSNLKDFDRRVNDNKTAAE
EALKRIPAINQTIAEANEKTRDVQLALGNAKADATEAKTKAHEAERIASAVQRNATSTKA
EAERTFTEVTGLDNEVNSMLRQLQEAENELKRKQDDADQDMMMAGMASQAAQEAEINARK
AKNSVNSLLSMINDLLEQLGQLETVDLNKLNEIEGTLNKAKDEMKVSDINRKVSDLENEA
RKQEAAILDYNRDIEEILKDIRNLEDIRNTLPTGCFNTPSIEKP
Download sequence
Identical sequences ENSDORP00000002059 ENSDORP00000002059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]