SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002139 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002139
Domain Number 1 Region: 101-129
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000131
Family LDL receptor-like module 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002139   Gene: ENSDORG00000002283   Transcript: ENSDORT00000002278
Sequence length 131
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6584:555:4554:-1 gene:ENSDORG00000002283 transcript:ENSDORT00000002278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GYRLLCCSGREACLSAFLLLLLATLAALLVLVIILGLPSRTSXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXDVPQSLPSFLVAHCGNPASWIYSDQKCDGIN
NCGDCSDELSP
Download sequence
Identical sequences ENSDORP00000002139 ENSDORP00000002139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]