SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002146 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002146
Domain Number 1 Region: 74-305
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.07e-58
Family Ankyrin repeat 0.00000456
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002146   Gene: ENSDORG00000002287   Transcript: ENSDORT00000002285
Sequence length 524
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5063:5641:15948:1 gene:ENSDORG00000002287 transcript:ENSDORT00000002285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEHLELLAEMPMVGRMSTQERLKHAQKRRAQQVKLWAQAEREAQGRKGPGEQSQKEAAG
QGQQKQVLFPPSVVLLEAAARSDLEEVLQLLKSGVSPDLANEDGLTALHQCCIDDFQEMV
QQLLEAGADVNARDSECWTPLHAAATCGHLHLVELLISSGADLLAVNTDGNMPYDLCEDE
QTLDCLETAMANRGITQESIEEARAVPELHMLDDLQSLLHAGADLNEPLDNGATLLHIAA
ANGFSEAAALLLEHGASLSAKDQDGWEPLHAAAYWGQVHLVELLVALGADLNGKSLLDET
PLDLCGDEEVRAKLLELKHKQDALLRAQGRQRSLLRRRTSSAGSRGKVVRRVSLTQRTNL
YRKEHAQEAIVWRQPPPTSPESPEEDEDRQTDAELRLQHPEEDPKDPKPAGTHNGRAGLP
PGRHLYSKRLDRSVSYQLSPLESTAPDAAVRDRAHHTLAQLKRQRAAAKLQRPPSEGTQS
PGQPEDSENSQPDGGPRAVGDPPLLLTAPCEEAPVEKRPCCLLM
Download sequence
Identical sequences ENSDORP00000002146 ENSDORP00000002146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]