SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002147 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002147
Domain Number 1 Region: 145-253
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.28e-35
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 2 Region: 262-370
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.19e-33
Family Spermadhesin, CUB domain 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002147   Gene: ENSDORG00000002289   Transcript: ENSDORT00000002286
Sequence length 380
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6584:119581:126874:-1 gene:ENSDORG00000002289 transcript:ENSDORT00000002286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAAWGSCLLLAVVLLHPGPRAQATKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXVCGGVLTGLSGVLTSPEYPNNYPNNVECHWVIHASGP
AAVKLVFMDFQVEGSEQCTYDYVAVLGAPGPAHGHHYCGSTRPPTLTSLGHELQVVFKSD
FNIGGRGFKAYYFSGECQELYTAVRGNFSSPQYPGSYPNNIRCHWTIRLPPGYRVKVFFL
DVDLEEPNSLTRTCDFDHLAAFDGDSEEAAPLGNWCGRHLPPPITSSHNQLLLLLHTDRS
TTGRGFSVAYIGGQLGWGDG
Download sequence
Identical sequences ENSDORP00000002147 ENSDORP00000002147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]