SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002156 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002156
Domain Number 1 Region: 2187-2417
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000369
Family Pectin lyase 0.083
Further Details:      
 
Domain Number 2 Region: 254-312
Classification Level Classification E-value
Superfamily E set domains 0.00000000204
Family E-set domains of sugar-utilizing enzymes 0.049
Further Details:      
 
Domain Number 3 Region: 1014-1096
Classification Level Classification E-value
Superfamily E set domains 0.00000028
Family E-set domains of sugar-utilizing enzymes 0.074
Further Details:      
 
Domain Number 4 Region: 922-998
Classification Level Classification E-value
Superfamily E set domains 0.000000525
Family E-set domains of sugar-utilizing enzymes 0.055
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000002156
Domain Number - Region: 360-410,437-452
Classification Level Classification E-value
Superfamily Anthrax protective antigen 0.000811
Family Anthrax protective antigen 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002156   Gene: ENSDORG00000002272   Transcript: ENSDORT00000002295
Sequence length 4043
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5290:161426:383176:-1 gene:ENSDORG00000002272 transcript:ENSDORT00000002295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGWLISLSFEVLFLAVPHPSLHIEPREGSLAGGTWVTVVLDGEESGVLHPANASQPEIH
LVNVALPTLPRVPCDVSPVFWDLPVVICQTRALLSEGQAGTYAVEVRSGGQVVGGPGPGS
HDNCTFKFSKAQTPLVYQVSPPSGVPGQLIQVYGWIITGRLETFDLGVEYIDXXXXXXXX
XXXXXXXXXXXXXXXXXXYPVREAGGIGTLQCRVDGSYIXXXXXXXXXXXXXXSMVDKGA
WLVSAKQDLFLFQTHPEILSVFPETGSLGGGTDITVTGAFFDVPTRVTVAGIPCDISRVS
PREITCTTRAPGKGTRLTAPQAGNRGLLFEVGAASEGSELTEASPGYRRQIVPNASAPLG
FWSQEGQPFKARLSGFFVAPETNNYTFWIQAGSQASLHLSWSEEPRDKARVAFIGVGTAD
WFDSWEHGDAGVWQQKTPKMELRGGAKYYLEAEQQGRAPSAGVRIGVQLHNTWLTAGQVA
TYLREKHQLRARAQRRPEVQMLDVSGPGNFFLTWGNVSSPPLPANATAHQIQTTLEALLA
VKCSVEPASAGLLLRLGFEQGLEASSSDGVLTCATGPFCGRFSLCQPGHLVVTPPVAPKG
YRLAQFPHLCIAYKGHANTSLRVVVTFTAGSAGVPENITCAWSPAPAGPERWRFACTDLW
DTCVRHSRLRTPSASVPVLVQQLSLPRAPETDVLCVDEVIITDTNLTVSQADLGTARPGG
NLVESVSVVGSPPLFNVSVWPAGCGLQLPLLTACSVSSEAAGGGCGRRAPARRLQRPSPP
LGGHFSLRLLHTVIPDIPVGTSASGLHQLLRDNAQGAPCGPLKAADFTVEEQGSCYERVW
SLSWPMQTGDLPDMIGVSHHNLTGVDATAEVRVVYDGGVFLGPIFGDMLATANPQAQVVV
EVNGVPAHCAGPCSFQYLPGVTPRVRSVWYSLDGDTNLLVYMTGVGFSATAQALQVTVNR
TSCQVVFSNQTNVVCRTGLLPVGVHQLSVWVRPVGLAVSESGEGIFLSVETRLEAVEPAR
GADTGGLWALIRGPRLDGAHLVLFGSQSCTINATASNSRRIHCRVPPRGEDGYTVNVTVV
RGGHSAVLPGAFTYIPSLSLVVVSLSRNQSNIAGGEPLFLGVTQLENYTDLEVEICIQGS
LAQLHAWTAWGLAVVLAPWPPALHRTSVSIHVGSHGVDLRINCTTEVCTMSPCCGSLLXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCLGGQ
LVHACGAGLSPGNISAAVCGYPCQVLPNTTAPALGCLLLPLDVSVAPLCDLQPRGDTRGK
ARHTHVQCNLTVTVGTEMLPKAWPYLCVCEQRLQDLLASDHGTEPASLSFLGLFVXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGGFALQSCRRWSRA
CSWRSAGMPQDGANVTVEKGQWLLLDTNTSLLNSLHIRGGKLIVLGPGPVELRAHSILIS
DGGELRIGTEDKPFEGMAQITLHGSSHSTPFHPYGVKFLALRNGTLALHGALPEVTVTCL
RAAARAQDTMLALEDAVAWRRGDEVAVISGAGGEGGQPVQETVTVEAVHGADLQLRAPLR
YSHNVTEHWVAGERLALKAVVVLLSRKISIRGNLTSERVELLTSCQESSTSEDDLKHCLY
SKSEKMLGSRDLGARVIIQSSPDEPSLVQMRGVQLRDLGQSFRKHGSAVTLVGALRGSYV
HGCVVRNSFSRGLSLLRTWGLRVDSNVFYKISGHALLVGMYMDIRNPAQDAPPGRKWDRS
EQGNIITNNVIIGVSGAEGLSSLEMLAPSAIYIRSPTNVVEGNRVYGAGYGYFFHLVTRQ
TSQAPLLSFTQNKAHSCTRSGLFVYPKYQPPWDPDMGPTLFQNFMVWGSAGGVQISRSSN
LHLKNFQVYSCRDFGFDILESDAXXXXXXXXXXXXXXXXRNLCMSTGIKTPKRRELMISN
TTFVNFDLFNCVAIRTCSGCSPGGGFTVTTKQLKFANSSNLVAFPFPHAAVLEDVDGSLS
GKNGSHILASVETLSASCAANASFSGLVLGSVCGEDVVFHRMSIGLANAPDVSYDLTLID
SRNKTTTVNYVHDTLSNHHGWVALLLDRETYSLQFERPQRDRSLQYSATFYNFAPGRYLL
LEHRDAPPHPDILLTCSGRLGHSLPSLPSPGRDQHCDWFFNAQQRRLTYLISGEGQVGVT
LQVMEGAPPTLSASTSEPNGPLPWSHPETWQDVGEGWGGYNSTLPRPGDDVMIPPNRTVL
VDIDLPWLRGLYVLGTLEFPVDRSNVLSVACLAILGGELRAGTLENPIEKERKLLIHLRA
SEGVSCNRLYGIQLDPGTIGVYGKLLLHSAYPKKSWTQLGADIAPGNERILVQEVLDWRP
QDKIVLCPSSYEPHEAEVLTVRAVRGRHVSIQERLQYRHLGGAHVVEDGQSIRLAVAVGL
LTRNVQIRSDTACRGRILVGSFQNSTREEFSXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXVTFSNFVRSCHGDDLDICILPNAENTGMVPPVTAE
RTRMLKIKERNKFCFSPVIPXXXLERVICPESNCENPKKYLFKDLDGKTLGLPPPVSVFP
KIEAEWTGSFFDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFSIMDNLLYVVLQGEEP
IEIRISVSIHLAFTVITASPEKGWEIFGRLADFLQINTSQVRLTHEKSGNEETLKTIADS
RAKRKHTCPTVTCASDSRSISLRRPLAVEMSSYLVFPATSLETISKVIVVEIGDPPAVRS
TGETPSLPSSKLQSLAGQLITAQQTGQLEAILKVTVGALLVTQPAADLSCGNASSPGPGS
RVYVRPYALSVLVQPSDGEVGKKLVVQPRLVVLDRQNRRVESLGMPSAPWIISVSLEGSA
DSALTGCTRAETQDGYVSFSDLAVLVSGSSWHFTFTVTSPAGVNFTARSAPFAVLWVAGK
ERSAVALAAVLCAVISWLALCCLLCCWFKRSRSRKTKPEETPESQMNDSDHHIRVSARRQ
GSQEGTAKDCAVVGEDLRLKVAPNHCLLRSLDGVSRRKVGQDPAREVEATVPAPRVTGRP
SQGAQKMTRDWKEVQQQLPRYQLAGRDQLLLLRCPERRQDRWLWPGPSRGSQERSSLGLS
QEKKACCAWATEAAGLRAQEQLR
Download sequence
Identical sequences ENSDORP00000002156 ENSDORP00000002156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]