SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002186 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002186
Domain Number 1 Region: 140-355
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 9.38e-36
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.000000511
Further Details:      
 
Domain Number 2 Region: 378-508
Classification Level Classification E-value
Superfamily Ricin B-like lectins 5.27e-28
Family Ricin B-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002186   Gene: ENSDORG00000002329   Transcript: ENSDORT00000002328
Sequence length 509
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5697:1517:10478:1 gene:ENSDORG00000002329 transcript:ENSDORT00000002328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIFNQRDQELRDLGYQKHAFNMLISNRLGYHRDVPDTRNAAXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXEVLVFLDSHCEVNVAWLQPLLAAILQDPHTVVCPVIDIISA
DTLAYSASPIVRGGFNWGLHFKWDLVPLSELGGADGATAPIKSPTMAGGLFAMNRQYFNE
LGKYDGGMDIWGGENLEISFRIWMCGGSLFIIPCSRVGHIFRKRRPYGSPEGQDTMTHNS
LRLAHVWLDEYKEQYFSLRPDLKSRSYGNISERVELRKKLGCQSFKWYLDNIYPEMQIPG
PNAKPQQPAFLNRGPKRPKVLRRGRLYHVQTNKCLVAEGRPSQKGSLVVLKACDYADPAQ
IWIYNEDHELVLSNLLCLDMSETRSSDPPRLMKCHGSGGSQQWTFGKKNRLYQVSVGQCL
RAVEPLGQPGAVAMGICDGSAAQQWHLDG
Download sequence
Identical sequences ENSDORP00000002186 ENSDORP00000002186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]