SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002242 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002242
Domain Number 1 Region: 225-318
Classification Level Classification E-value
Superfamily Immunoglobulin 2.98e-20
Family I set domains 0.0069
Further Details:      
 
Domain Number 2 Region: 330-372
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000341
Family EGF-type module 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002242   Gene: ENSDORG00000002385   Transcript: ENSDORT00000002385
Sequence length 585
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4340:2129:73120:-1 gene:ENSDORG00000002385 transcript:ENSDORT00000002385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRQVSALPPPPPLEKARCSSDSDSSSSSSSESSSSRSSSSSSSSISRPAAPPEPRPQPPP
QPRFPAARKAAARSRAAAAGGMRRDPAPGFSMLLFGVSLACYSPSLKSVQDQAYKAPVVV
EGKVQGLAPAGGSGSNSTREPPASGRVALVKVLDKWPLRSGGLQREQVISVGSCAPLERN
QRYIFFLEPTEQPLVFKTXXXXXXXXXXXXXXXXXXXXXXXXXTRPKLKKMKSQTGQVGE
KQSLKCEAAAGNPQPSYRWFKDGKELNRSRDIRIKYGNGRKNSRLQFNKVKVEDAGEYVC
EAENILGKDTVRGRLHVNSVSTTLSSWSGHARKCNETAKSYCVNGGVCYYIEGINQLSCK
CPNGFFGQRCLEKLPLRLYMPDPKQSFLSFSKAEELYQKRVLTITGICVALLVVGIVCVV
AYCKTKKQRKQMHNHLRQNMCPAHQNRSLANGPSHPRLDPEEIQMADYISKNVPATDHVI
RRETETTFSGSHSCSPSHHCSSATPTSSHRHESHTWSLERSESLTSDSQSGIMLSSVGTS
KCNSPACVEARARRAAAYSLEERRRAAMPPYHDSIDSLRDSPHSE
Download sequence
Identical sequences ENSDORP00000002242 ENSDORP00000002242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]