SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002285 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002285
Domain Number 1 Region: 274-425
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.7e-49
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00000007
Further Details:      
 
Domain Number 2 Region: 26-141
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-32
Family Spermadhesin, CUB domain 0.00037
Further Details:      
 
Domain Number 3 Region: 478-585
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.54e-31
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00000151
Further Details:      
 
Domain Number 4 Region: 645-803
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.32e-27
Family MAM domain 0.0028
Further Details:      
 
Domain Number 5 Region: 220-262
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000458
Family Spermadhesin, CUB domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002285   Gene: ENSDORG00000002431   Transcript: ENSDORT00000002432
Sequence length 922
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1003:14380:178450:-1 gene:ENSDORG00000002431 transcript:ENSDORT00000002432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERGPPLAGAALALALALAGAFRNDKCGGTIKIESPGYLTSPGYPHSYHPSEKCEWLIQA
PDQYQRIMINFNPHFDLEDRDCKYDYVEVIDGENENGHLWGKFCGKIAPSPVVSSGPFLF
IKFVSDYETHGAGFSIRYEIFKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPHIGRYCGQKTPGRIRSSS
GILSMVFYTDSAIAKEGFSANYSVLQSSISEDFKCMEALGMESGEIDSDQITASSQYSTN
WSAERSRLNYPENGWTPGEDSYREWIQVDLGLLRFVTAVGTQGAISKETKKKYYVKTYKI
DISSNGEDWITIKEGNKPVIFQGNTNPTDVVFGVFPKPLITRFVRIKPTTWETGISMRFE
VYGCKITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHPY
VNEWLQVDLGEEKIVRGIIIQGGKHRENKVYMRKFKIGYSNNGSDWKMIMDDSKRKAKSF
EGNINYDTPELRTFPPLSTRFIRIYPERATHGGLGLRMELLGCEVEAPTAGPTTPNGNPV
DECDDDQANCHSGTGDDFQLTGGTTVLSTEKPTMLDSTIQSEFPTYGFNCEFGWGSHKTF
CHWEHDNHVQLKWSVLTSKTGPIQDHTGDGNFIYSQADENQKGKVARLVSPVVYSQNSAH
CMTFWYHMSGSHVGTLRVKLRYQKPEEYDQLVWMAIGHXXXXXXXXXXXXXXXXXXXXVI
FEGEIGKGNLGGIAVDDISINNHISQEDCAKPADLDKKNSEIKIDETGSTSGYEGHGDGD
KNISRKPGNVLKTLDPILITIIAMSALGVLLGAVCGVVLYCACWHNEMSEGLSALENYNF
ELVDGVKLKKDKLNTQNTYSEA
Download sequence
Identical sequences ENSDORP00000002285 ENSDORP00000002285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]