SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002313 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002313
Domain Number 1 Region: 878-1181
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.56e-93
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000458
Further Details:      
 
Domain Number 2 Region: 1140-1441
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.2e-79
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000153
Further Details:      
 
Domain Number 3 Region: 25-186
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-35
Family MAM domain 0.00000629
Further Details:      
 
Domain Number 4 Region: 386-585
Classification Level Classification E-value
Superfamily Fibronectin type III 3.91e-28
Family Fibronectin type III 0.00079
Further Details:      
 
Domain Number 5 Region: 284-421
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000929
Family Fibronectin type III 0.004
Further Details:      
 
Domain Number 6 Region: 189-282
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000324
Family I set domains 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002313   Gene: ENSDORG00000002463   Transcript: ENSDORT00000002463
Sequence length 1446
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4369:181322:250834:1 gene:ENSDORG00000002463 transcript:ENSDORT00000002463 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARAQALVLALTFQLCAPETETPAAGCTFEEVSDPAVPCEYSQAQYDDFQWEQVRIHPGT
RASADLPHGAYLMVNASQHAPGQRAHVIFQSLSENDTHCVQFSYFLYSRDGHSPGTLGVY
VRVNGGPLGSAVWNMTGSHGHQWHQAELAVSTFWPNEYQVLFEALISPDRRGYMGLDDIL
LLSYPCAKAPHFSRLGDVEVNAGQNASFQCMAAGRAAEAERFFLQRQSGLLVPAASVRHI
SHRRFLATFPLAGVGRAEQDLYRCVSQAPRGAGVSNFAELIVKEPPTPIAPPQLLRAGPT
YLIIQLNTNSIIGDGPIVRKEIEYRMTRGPWAEVHAVNLQTYKLWHLDPDTEYEISVLLT
RPGDGGTGRPGPPLLSRTKCAEPMRAPKGLAFAEIQARQLTLQWEPLGYNVTRCHTYTVS
LCYHYIPGSSHNQTIRECVKMERGASRYTIKNLQPYRSVHVRLVLTNPEGRKEGKEVTFQ
TDEDVPGGIAAESLTFTPLEDMIFLKWEEPQEPNGLITQYEISYQSIESSDPAVNVPGPR
RTISKLRNETYHVFSNLHPGTTYLFSVRARTGKGFGQAALTEITTNISAPSFDYADMPSP
LGESENTITVLLRPAQGRGAPISVYQVIVEEERPRRLRREPGGQDCFPVPLTFETALARG
LVHYFGAELAASSLPEATPFTVGDNQTYRGFWNPPLEPRKSYLIYFQAASHLKGETRLNC
IRIARKAACKESKRPLEVSQRSEEMGLILGICAGGLAVLILLLGAIIVIIRKGXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDQRS
SGVTEASSLLGGSPRRPCGRKSSPYHTGQLHPAVRVADLLQHINQMKTAEGYGFKQEYES
FFEGWDATKKKDKLKGSRQESMPAYDRHRVKLHPMLGDPNADYINANYIDGYHRSNHFIA
TQGPKPEMIYDFWRMVWQEHSSSIVMITKLVEVGRVKCARYWPEDSDMYGDIKITLMKTE
TLADYVVRTFALERRGYSARHEVRQFHFTAWPEHGVPYHATGLLAFIRRVKASTPPDAGP
IVIHCSAGTGRTGCYIVLDVMLDMAECEGVVDIYNCVKTLCSRRVNMIQTEEQYIFIHDA
ILEACLCGETTIPVNEFKATYREMIRIDPQSNSSQLREEFQTLNSVTPPLDVEECSIALL
PRNRDKNRSMDVLPPDRCLPFLISTDGDPNNYINAALTDSYTRSAAFIVTLHPLQSTTPD
FWRLVYDYGCTSIVMLNQLNQSNSAWPCLQYWPEPGRQQYGLMEVEFVSGTADEDLVARV
FRVQNISRLQEGHLLVRHFQFLRWSAYRDTPDSRKAFLHLLAEVDKWQAESGDGRTVVHC
LNGGGRSGTFCACATVLEMIRCHSLVDVFFAAKTLRNYKPNMVETMDQYHFCYDVALEYL
EGLESR
Download sequence
Identical sequences ENSDORP00000002313 ENSDORP00000002313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]