SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002333 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002333
Domain Number 1 Region: 248-459
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.16e-57
Family Reprolysin-like 0.00053
Further Details:      
 
Domain Number 2 Region: 546-601
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000196
Family TSP-1 type 1 repeat 0.00024
Further Details:      
 
Domain Number 3 Region: 1478-1537
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000222
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 4 Region: 1425-1478
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000012
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 5 Region: 831-887
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000458
Family TSP-1 type 1 repeat 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002333   Gene: ENSDORG00000002483   Transcript: ENSDORT00000002484
Sequence length 1600
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1862:25705:221053:-1 gene:ENSDORG00000002483 transcript:ENSDORT00000002484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCARRSRLAALAVVAQLLHWGALCRGRQPQPHPGPPVRFPDPRQEHFIKALPEYYMVGP
TRVDAYGEFLSYGLNHPISTSRSKRDVDGSQDRVYYKIAHEEKDLMFNLTVNWRFLSNSY
IVEKRYGNLSHAKMVVASGPPCHLRGTVLQQGVTVGTATLSACHGLMGIFHLPHGDFFIE
PVRKHPPAEEGYQLHVVYRRQRQRVAETEEPTCGLKDSGANPKKQELQREKWERNHLPSR
SLSRRSISKERWVETLVVADTKMVEYHGGENVESYILTIMNMVTGLFHNPSIGNAIHIVV
VRLILLEEEEQGLKIVHHAEKTLSSFCKWQKSINPKSDLNPAHHDVAVLLTRKDICAGVN
RPCETLGLSHLSGMCQPHRSCNINEDSGLPLAFTIAHELGHSFGIQHDGKDNDCEPVGRH
PYIMSHQLQYDPTPLTWSKCSKDYITRFLDRGWGFCLDDIPKKKGLKSKVIAPGVIYDVH
HQCQLQYGPNATFCQEVENVCQTLWCSVKGSCRSKLDATADGTRCGEKKWCMAGKCITVG
KKPESIPGGWGRWSAWSHCSRTCGAGAQSAERLCNNPEPKFGGKYCTGERKRYRLCNVHP
CRTDSPTFRQMQCSEFDTVPYKNEFYHWFPVFNSARPCELYCRPIDGRFSEKMLDAVIDG
TPCFEGGNSRNVCINGICKVVGCDYEIGSSATEDRCGVCLGDGSACQTVRKMFKQKEGSG
YVDIGLIPKGARDIRIMEIKAAGNFLAIRSEDPEKHYLNGGFIIQWNGNYKLAGTVFQYD
RKGDLEKLMAPGPTNESVWIQLLFQVTNPGIKYEYTIRKDGLDNDVEKLMYFWQFGRWTE
CSVTCGTGIRRQTAQCVKKGHGLVKATFCDPETQPNGRQKKCYEKDCPPXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQAGIPPLLSMSCNPEPCEEWQVEPWSQ
CSRSCGGGIQERKVSCPGSLCDWTKRPPSTVSCNSHLCCHWATGDWNLCNTSCGGGFQKR
TVHCVPSEDNTTEESDQCLCDHEPRPPEFQKCNQQACRKNADIHCTKDRLSASFCQTLKS
MKKCSVPTVRAQCCSSCSQTHSIHAQWPRKQQLLKKPKLP
Download sequence
Identical sequences ENSDORP00000002333 ENSDORP00000002333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]