SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002361 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002361
Domain Number 1 Region: 82-286
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-54
Family SPRY domain 0.0000146
Further Details:      
 
Domain Number 2 Region: 41-92
Classification Level Classification E-value
Superfamily F-box domain 0.000000000024
Family F-box domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002361   Gene: ENSDORG00000002517   Transcript: ENSDORT00000002515
Sequence length 289
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5485:4522:19897:1 gene:ENSDORG00000002517 transcript:ENSDORT00000002515 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAGEVMAAPGPGAGAASGGAGCSGGGAGAGAGSGSAGAGGRLPSRVLELVFSYLELSELR
SCALVCKHWYRCLHGDENSEVWRSLCARSLAEEALRTDILCNLPSYKAKVRAFQHAFSTN
DCSRNVYIKKNGFTLHRNPIAQSTDGARTKIGFSEGRHAWEVWWEGPLGTVAVIGIATKR
APMQCQGYVALLGSDDQSWGWNLVDNNLLHNGEVNGSFPQCNNAPKYQIGERIRVILDME
DKTLAFERGYEFLGVAFRGLPKACLYPAVSAVYGNTEVTLVYLGKPLDG
Download sequence
Identical sequences ENSDORP00000002361 ENSDORP00000002361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]