SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002369 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002369
Domain Number 1 Region: 1-134
Classification Level Classification E-value
Superfamily UBC-like 3.54e-56
Family UBC-related 0.00000028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002369   Gene: ENSDORG00000002525   Transcript: ENSDORT00000002523
Sequence length 137
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_63:43005:51834:1 gene:ENSDORG00000002525 transcript:ENSDORT00000002523 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFSEEYPNKPPTVRFLSK
MFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKR
EYEKRVSAIVEQSWNDS
Download sequence
Identical sequences G7P8A5
ENSDORP00000002369 ENSMEUP00000004327 ENSDORP00000002369 ENSMEUP00000004327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]