SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002400 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002400
Domain Number 1 Region: 29-147
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 5.23e-40
Family Frizzled cysteine-rich domain 0.00000022
Further Details:      
 
Domain Number 2 Region: 173-284
Classification Level Classification E-value
Superfamily TIMP-like 1.48e-25
Family Tissue inhibitor of metalloproteinases, TIMP 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002400   Gene: ENSDORG00000002556   Transcript: ENSDORT00000002555
Sequence length 320
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4578:49152:68344:-1 gene:ENSDORG00000002556 transcript:ENSDORT00000002555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCCLLLRAGLLALAALCLLQVPRGARAAACEPVRIPLCKSLPWNMTKMPNHLHHSTQANA
ILAIEQFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEPIKPCKSVCERARQGCEPILVK
YRHAWPESLACEELPVYDRGVCISPEAIVTAEGAXXXXXXXXXXXXXXXXXRCKCKPIRA
TQKTYFRNNYNYVIRAKVKEVKTKCHDVTVIVEVKEILKASLVNIPRDTVNLYTSSGCLC
PPLHVNEEYIIMGYEDEERSRLLLVEGSIAEKWKDRLGKKVKRWDVKLRHLGLSKTDSGI
GDSTQNQKSGRNSNPRPART
Download sequence
Identical sequences ENSDORP00000002400 ENSDORP00000002400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]