SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002442 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002442
Domain Number 1 Region: 6-246
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.54e-85
Family Eukaryotic proteases 0.0000997
Further Details:      
 
Domain Number 2 Region: 300-538
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.82e-73
Family Eukaryotic proteases 0.00016
Further Details:      
 
Domain Number 3 Region: 679-777
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.06e-34
Family Eukaryotic proteases 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002442   Gene: ENSDORG00000002599   Transcript: ENSDORT00000002599
Sequence length 778
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5699:900:15230:1 gene:ENSDORG00000002599 transcript:ENSDORT00000002599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CGLQPAWRTAGRIVGGVEAAPGEFPWQVSLRENNEHFCGATIIGPTWLLSAAHCFNEFQD
PAEWVASAGTTHLSGAAPGAVRVRVAQITPHPRYDADTADFDVAVLRLARPLRFGRYVQP
ACLPGAAHVFPPGRKCLISGWGYLKEDFLVKPEVLQKATVELLDQALCASLYGHSLTDRM
LCAGYLDGKVDSCQGDSGGPLVCEEPSGRFFLTGIVSWGIGAEARRPGVYARVTRLRDWI
LEMINMASLPPVSTVAPVPTTSSATWLTSPASPSVGTSTKPTLAPSTAPLASVTAAKPQE
CGARPAMEKPIRIVGGFGAVPGEVPWQASLKEGSRHFCGATWLTAGCYLTKAEQVQAHLG
TASLLGTGGSPVKLGLRRVVLHPRYNPSILDFDVALLELARPLVFNKYIQPVCLPLAIQK
FPVGRKCMISGWGNMQEGNATKPEVLQKASVGVIEQKVCSSLYNFSLTDRMLCAGFLEGR
VDSCQGDSGGPLACEETPGIFYLAGIVSWGIGCAQANKPGVYARITRLKGWILHTMSVAP
VPTPRPSSTRRTPATTRPPHRMTTPEATTSTATSPKATSKATTRPANTTIPSRATPAAGQ
ILSTAAAAPMETTTRSQPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXYGGGSMARQLQKAAVRLFSEQTCRRFYPVQISSRMLCAGFAQGG
VDSCSGDAGGPLACREPSGRWVLTGVTSWGYGCGRPHFPGVYTRVAAVRGWIAQNIQE
Download sequence
Identical sequences ENSDORP00000002442 ENSDORP00000002442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]