SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002451 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002451
Domain Number 1 Region: 7-78
Classification Level Classification E-value
Superfamily RING/U-box 6.19e-20
Family RING finger domain, C3HC4 0.0081
Further Details:      
 
Domain Number 2 Region: 86-147
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000244
Family B-box zinc-binding domain 0.003
Further Details:      
 
Domain Number 3 Region: 269-327
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000111
Family SPRY domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002451   Gene: ENSDORG00000002608   Transcript: ENSDORT00000002609
Sequence length 328
Comment pep:novel scaffold:dipOrd1:scaffold_23124:12600:13767:1 gene:ENSDORG00000002608 transcript:ENSDORT00000002609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPDTAQAFQKELRCAICINTFIEPVTLECGHSFCRPCLCLCWEETQTPATCPVCRGPCQ
QRDLKTNVVLRSLVAIARRASLRHFLSSQKYMCGTHRETKQMFCEVERALLCRSCSQSQE
HRAHKHHPIERAAEEQREMISKQMHAVWEKTQENQHNLQEKRRMTKDVFRVLFLELDIQE
EERHHSQLLINEGRAMLLQLRERETQMLQKKHQLRNMYQKLIETYQKPDVDLLQEIAFNE
ARIKILGAVWTRHAVLNSEESFHFTALDAKFSSGKQYWEVSVDDSSTWALGVTRHSSIES
NLTESEDFLLLFVKENTFHHFTTSPLLP
Download sequence
Identical sequences ENSDORP00000002451 ENSDORP00000002451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]