SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002464 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002464
Domain Number 1 Region: 13-214
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.2e-32
Family Ankyrin repeat 0.00097
Further Details:      
 
Domain Number 2 Region: 224-269
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000034
Family SOCS box-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002464   Gene: ENSDORG00000002622   Transcript: ENSDORT00000002622
Sequence length 271
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_21560:1407:6263:1 gene:ENSDORG00000002622 transcript:ENSDORT00000002622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RINEKSVWCCGWLPCTPLRIAATAGHGNCVDFLIRKGAEVDLVDVKGQTALYVAVVNGHL
ESAQILLEAGADPNGSRHHRSTPVYHASRVGRADLLKALIRYGADVDINHHLTPDAQPPF
SRRLTSLVVCPLYISAAYHNLQCFRLLLQAGANPDFNCNGPVNTQEFYRGSPACVMDAVL
RHGCEAAFVSLLVEFGANLNLVKWESLGPESRGRRKADPEALQVFKEARSVPRTLLSLCR
VTVRRALGKYRLHLIPSLPLPDPIKRFLLHE
Download sequence
Identical sequences ENSDORP00000002464 ENSDORP00000002464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]