SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002492 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002492
Domain Number 1 Region: 1-82
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.45e-24
Family Ras-binding domain, RBD 0.0074
Further Details:      
 
Domain Number 2 Region: 1016-1078
Classification Level Classification E-value
Superfamily SH3-domain 8.27e-20
Family SH3-domain 0.00017
Further Details:      
 
Domain Number 3 Region: 887-952
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000118
Family Ankyrin repeat 0.0000495
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002492   Gene: ENSDORG00000002653   Transcript: ENSDORT00000002653
Sequence length 1087
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2030:52685:80661:-1 gene:ENSDORG00000002653 transcript:ENSDORT00000002653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILTVFLSNNEQILTEVPITPETTCRDVVEFCKEPGEGSCHLAEVWRGNERPIPFDHMMY
DHLQKWGPRREEVKFFLRHEDSPAESNEQGSRQTQEQRAQRSVMSVPGEKRTENGVGNPR
VELTLSELQDMAARQQQQIENQQQMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIRNQLNQEQNSKLQQQKELLNKRNMEV
AMMDKRIGELRERLYGKKIQLNRVNGTSSPQSPLSASGRVAAVGPYIQVPSAGSFPVPGD
PVKPQSLTITSSAAHGRTKPANDGSWPTLKQNSGSSVKPTQMSSADWKDPVMEGTLKQGA
ISSQPVPLSALGSTEKLGIEIGKGPPPIPGVGKPLPPSYGTYPSPAPLAPGSTGSLERRK
EGSLPRPSTGGPSRQKPAPLPPAGSAPQPGSSQQIQQRISVPPSPTYPPAGPPAFPAGDG
KPDLPLTVAIRPFLADKGSRPQSPRKGPQTVNSSSIYSMYLQQATPPKNFQPAVHGTLNK
SIKAVYGKPVLPSGSTSPSPLPFLHGSMGTGTSQPQPSSECADKEPEQEGPAAPGDGSAV
ESLPRPLSPTKLTPIVHSPLRYQSDADLEALRRKLANAPRPLKKRSSITEPEGPGGPNIQ
KLLYQRFNTLAGGMEGTPFYQPSPSQDFVGTLADVDNGNTNANSNVDEPAPAQPTVPLPD
EPAPSSDANDNQLPSPEPQELICPPTTHHTAEPTEDNNNNVATAPSTEQTPSPVAESPSL
GEEQVPPAPLPAAVHPPAASTSKRTNLKKPNSERTGHGLRVRFNPLALLLDASLEGEFDL
VQRIIYEVEDPSKPNDEGITPLHNAVCAGHHHIVKFLLDFGVNVNAADSDGXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVQEKLGVMNKGT
VYALWDYEAQNSDELSFHEGDAITILRREDDSETEWWWARLGGREGYVPKNLLGLYPRIK
PRQRTLA
Download sequence
Identical sequences ENSDORP00000002492 ENSDORP00000002492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]