SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002513 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002513
Domain Number 1 Region: 290-480
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.4e-60
Family Hemopexin-like domain 0.0000282
Further Details:      
 
Domain Number 2 Region: 112-260
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.33e-36
Family Matrix metalloproteases, catalytic domain 0.00000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002513   Gene: ENSDORG00000002674   Transcript: ENSDORT00000002675
Sequence length 487
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5175:14835:26579:1 gene:ENSDORG00000002674 transcript:ENSDORT00000002675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARAAGFRSAAPRALLLLLLLALLPPLLARARPPXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXILRFPWQLV
QEQVRQTVAEALQVWSEVTPLTFTEVHEGHADIMIDFTRYWHGDNLPFDGPGGILAHAFP
KTHXXXXXXXXXXXXXXXXXXXXXXTDLLQVAAHEFGHVLWLQHTTAAKALMSPFYTFRY
PLSLSPDDRRGIQHLYGRPHEATTSQAATLGPQNGVDTNEIAPLEPENPPDACEVSFDAV
STIRGELFFFKAGFVWRLRGGRLQPGYPALASRHWQGLPSPVDAAFEDAQGHIWFFQGSQ
YWVYDGEKPVLGPAPLSGLGLVWSPVHAALVWGAEKNKVYFFRGGDYWRFHPSTRRVDSP
VPRRATDWRGVPSEIDAAFQDADGYAYFLRGRLYWKFDPVKVKALESFPRLVGPDFFGCA
EPANTFR
Download sequence
Identical sequences ENSDORP00000002513 ENSDORP00000002513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]